KEGG   Saccharopolyspora sp. ASAGF58: FDZ84_21730
Entry
FDZ84_21730       CDS       T06538                                 

Definition
(GenBank) amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
sacg  Saccharopolyspora sp. ASAGF58
Pathway
sacg00240  Pyrimidine metabolism
sacg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sacg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FDZ84_21730
Enzymes [BR:sacg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     FDZ84_21730
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: QIZ36799
UniProt: A0A6H1RBD4
LinkDB
Position
complement(4522128..4523591)
AA seq 487 aa
MTVAPGSGLPASQIPDLVLLDAVELSWLIRRREISCVEAMETYLGHIDRINPAVNAIVSR
ADETELIDQARHRDKELDRGECAGWMHGFPIAVKDLSDAAGFPTTKGSPIFAESLATTDA
LHVRRMRDAGAIVIGKTNVPEFGLGSHTFNPVFGTTLNAYDPTRSAGGSSGGAGAALALR
MLPVADGSDFMGSLRNPAAWGNLVSLRPGFGRIPSEGFLSEPSVVGPMGRTVRDVAMLLS
TMAGPDERAPLSIEQDPELFTGSLDRDFEGTRIGWLGDFDGYLATETGLLDLCAEAFGAF
AEIGCEVEPVSRRLPVEQAWETFLLWRSWMVGRDNIDLHADPATRAMLKPEVVFEVEGYQ
QLTAHDIGRALTGRDEWYAAVSRLFDEYDFLLAPSAQVFPFDVDQRWPQEIAGRSMDTYH
RWMETVAPWTLSGLPIASLPVGFNEAGLPMGVQLIGRNHAEWPLLQLANSYERATDWTHR
VLPPLLR
NT seq 1464 nt   +upstreamnt  +downstreamnt
gtgaccgtggcaccgggttccggactccccgcgtcgcagatccccgacctggtgctgctg
gacgccgtggagctgtcctggctgatccgccgccgggagatctcctgcgtcgaggcgatg
gagacctacctcggacacatcgaccggatcaacccggcggtgaacgcgatcgtctcccgc
gccgacgagaccgagctcatcgaccaggcgcggcaccgcgacaaggaactcgaccgcggc
gagtgcgcggggtggatgcacggtttcccgatcgcggtgaaggacctctccgacgcggcg
gggttccccaccacgaagggctcaccgatcttcgccgagagcctcgcgacgaccgacgcc
ctgcacgtgcggcggatgcgggacgccggcgcgatcgtcatcggcaagaccaacgtcccc
gagttcggccttggctcgcacaccttcaacccggtgttcggcaccacgctcaacgcctac
gaccccacgcgcagcgcgggcggcagcagcggcggcgccggggccgcgctggcgctacgg
atgttgccggtcgccgatggcagcgacttcatggggtcgctgcgcaaccctgcggcatgg
ggcaacctcgtgtccctgcggccaggcttcggccgcatcccgagcgagggattcctcagc
gagccctcggtggtcggcccgatggggcgcacggtgcgcgacgtcgcgatgctgctgtcc
acgatggccggtccggacgagcgtgcaccgctgagcatcgagcaggatccggagttgttc
accggcagcctggaccgcgacttcgagggcacccggatcggctggctcggcgacttcgac
ggatacctggccaccgagacgggcctgctggacctgtgcgccgaagccttcggcgccttc
gccgagatcggctgcgaggtcgagccggtgtcgcgccggctgccggtcgagcaggcctgg
gagaccttcctgctgtggcgctcgtggatggtcgggcgcgacaacatcgacctgcacgcc
gacccggccacccgggcgatgctcaaaccggaggtggtcttcgaggtcgagggttaccag
cagctcaccgcccacgacatcggacgcgccctgaccggccgggacgagtggtacgccgcg
gtgtcgcggttgttcgacgaatacgatttcctgctcgcaccgagcgcgcaggtgttcccg
ttcgacgtcgaccagcgctggccgcaggagatcgccggccggtctatggacacctaccac
cggtggatggagacggtcgcgccgtggacgctgtccgggctcccgatcgccagcctgccg
gtcgggttcaacgaggccgggttgccgatgggagtccagctgatcggccgaaaccacgcg
gaatggccgcttctgcagctggccaactcctacgaacgagccaccgactggacccaccga
gtcctgccacccctgctgcggtaa

DBGET integrated database retrieval system