KEGG   Streptomyces albidoflavus: XNR_4193
Entry
XNR_4193          CDS       T02545                                 
Name
(GenBank) Secreted protein
  KO
K14628  enoyl reductase
Organism
salb  Streptomyces albidoflavus
Pathway
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    XNR_4193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:salb01008]
    XNR_4193
Polyketide biosynthesis proteins [BR:salb01008]
 Polyketide tailoring proteins
  Others
   XNR_4193
SSDB
Other DBs
NCBI-ProteinID: AGI90526
UniProt: D6B1H6
LinkDB
Position
4752784..4753827
AA seq 347 aa
MPAVGRKTRGVALGAALFLLAGAAPAWADIVPGGGNGSGSEGEVGGGSGDDGTINASAGA
VVYDRSKNGSGQSAGPVTSASDWTPPACYYAPAFTPDQLKAELEPIWEAGSTGPEWDAEQ
RDRYVNGKPYKDFNKEKEGEGYWWDGFVADGRIGDPGALDCQKPNFWVDTGDAPPAGVPE
AITPEMLAQLAYAELRVPSTEVKLAPEVETKVNLPTWAWLDGATFKPVSVTASVPLLGMT
ATTTAEPVSLRIEPGTADARLHPASGECALVDGSIGERYAKGKADRTPPCGVTYLRSSGD
GTFPLQATLTWKISWTGTGVNDEQPLPDGSFGAQQPVTVREIQAVNR
NT seq 1044 nt   +upstreamnt  +downstreamnt
gtgccagccgtaggccgaaagaccagaggggtcgcgctcggcgcggcgctcttccttctc
gcgggcgccgcgcccgcctgggcggacatcgtgcccggcggcggtaacggcagcggttcg
gagggcgaggtgggcgggggaagcggcgacgacggcaccatcaacgcctccgccggagcc
gtcgtctacgaccgctccaagaacggctccggccagtccgccggccccgtcacctccgcc
tccgactggacgcctccggcctgctactacgccccggccttcacccccgaccagctgaag
gccgagctggagcccatctgggaggccgggtccaccggtcccgagtgggacgccgagcag
cgcgaccgctacgtgaacggcaagccctacaaggacttcaacaaggagaaggaaggcgag
ggctactggtgggacggcttcgtcgccgacggcaggatcggtgatcccggcgccctcgac
tgccagaagccgaacttctgggtcgacaccggcgacgccccgcccgccggcgtcccggag
gcgatcaccccggagatgctggcccagctcgcctacgccgaactgcgcgtgccctccacc
gaggtgaagctcgcccccgaggtggagaccaaggtcaacctgcccacctgggcctggctg
gacggtgccaccttcaagcccgtctcggtcaccgcctccgtgccgctgctcggcatgacg
gccaccaccaccgccgagccggtctccctgcgcatcgagcccggcacggccgacgcccgg
ctgcacccggcctccggtgagtgcgccctggtcgacggcagcatcggcgagcgctacgcc
aagggcaaggccgaccgcaccccgccgtgcggcgtgacctacctgcgctcctccggcgac
ggcaccttcccgctccaggccaccctgacctggaagatcagctggaccggaaccggcgtg
aacgacgaacagccgctgcccgacggctccttcggcgctcagcagccggtgaccgtgcgg
gagatccaggcggtcaatcgctga

DBGET integrated database retrieval system