KEGG   Streptomyces alboflavus: SMD44_00690
Entry
SMD44_00690       CDS       T05221                                 
Symbol
ptlI
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
salf  Streptomyces alboflavus
Pathway
salf00909  Sesquiterpenoid and triterpenoid biosynthesis
salf00998  Biosynthesis of various antibiotics
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SMD44_00690 (ptlI)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SMD44_00690 (ptlI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:salf00199]
    SMD44_00690 (ptlI)
Enzymes [BR:salf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     SMD44_00690 (ptlI)
Cytochrome P450 [BR:salf00199]
 Cytochrome P450, bacteria type
  CYP183 family
   SMD44_00690 (ptlI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ARX81292
UniProt: A0A1Z1W4G0
LinkDB
Position
complement(773392..774849)
AA seq 485 aa
MSSQPFTTGTAPGALPGLGHVWPLMRRPIEFLTSLPAHGDLVEIRLGPTRVYVPCHPELL
RQTLTDDRTFDKGGKYYDRARAMAGNGVATCAHKDHRRQRRLLQPAFHPTRLEAYATTME
QEVRALTDSWGDAEIIDAYPVLYALALRTVTRTLFSTRVTDAVVADIQHSFDIAFSGFFR
QMFMPPALLRLPLPANLRHQRALRNLNGIVDRVLRDSTAGESGEADARNVLSVLLASRKS
AADPGTGDADAGTGGTGTGGAGTGDGAAGATGADGRAADAEIHDQVVTVLAAGSETVAST
LTWAMYLLARNPAAQRRLQEEADSVLGGRPARWDDLPRLPHTHRVITETIRLYPPGWLFT
RVTTADVTLAGRHLRAGTTVVISPVPVHRNTGIFRRAADFDPDRWLPERTSGLPRGAFAG
FGTGPRKCIGDTFGVAECVLALTAVASHWSIGCAPGADIRPVPLAAFYRPRRLRLELNRR
AGHDA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtccagtcagcccttcaccaccggtacggctcccggcgcactgcccggcctcgggcac
gtctggcccctgatgcgacggcccatcgagttcctgacctccctgccggcccacggcgat
ctggtggagatcaggctcggcccgacgcgggtgtacgtcccgtgccaccccgagctgctg
cggcagaccctgaccgacgaccgcaccttcgacaagggcgggaagtactacgaccgggcc
cgggccatggccgggaacggtgtggccacctgtgcgcacaaggaccaccggcggcaacga
cggctgctccagcccgcgttccaccccacgcgcctcgaggcctacgcgacgaccatggaa
caggaagtgcgggcgctgaccgactcctggggcgacgccgagatcatcgacgcgtatccc
gtgctctacgcactcgccctgcggaccgtgacgcgcacgctcttctcgacccgggtcacc
gacgcggtcgtcgcggacatccagcactccttcgacatcgcgttcagcggattcttccgg
cagatgttcatgcccccggccctgctgcgcctgccgctgcccgcgaacctccggcaccag
cgtgccctgcggaacctcaacggcatcgtggaccgcgtgctgcgggactccacggcgggg
gagtcaggggaggcggacgcgcggaacgtcctgtcggtgctgctcgcgtcccgcaagagc
gctgccgacccgggcacgggcgacgccgacgcgggtacgggtggcacgggcacgggcggc
gccggcacgggcgacggcgcggcgggcgcgaccggcgccgacggacgagcggccgacgcc
gagatccacgaccaggtcgtcaccgtgctcgcggcgggcagcgagaccgtggcgtccacc
ctcacctgggcgatgtacctgctggcccggaacccggcggcccagcgccggctccaggag
gaggccgactccgtgctcggcggccgaccggcccgctgggacgacctcccgcgcctgccc
cacacccaccgcgtcatcacggagacgatccgactgtatcccccgggctggctgttcacg
cgggtcacgacggcggacgtcaccctggccgggcggcatctgcgggcgggcaccacggtc
gtcatcagcccggtcccggtgcaccggaacaccggcatcttccggcgggccgccgacttc
gaccccgaccggtggctgccggagcgcacctcggggctgccgcgcggggcgttcgccgga
ttcggcaccgggccgcgcaagtgcatcggggacaccttcggcgtcgccgagtgcgtcctc
gccctcaccgcggtcgcgagccactggtccatcggctgcgcgccgggggcggacatccgc
ccggtgcccctcgccgccttctaccgcccccgcaggctccgcctggagctcaaccggcgt
gccggccatgacgcctga

DBGET integrated database retrieval system