KEGG   Streptomyces alboflavus: SMD44_07458
Entry
SMD44_07458       CDS       T05221                                 
Symbol
pps
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
salf  Streptomyces alboflavus
Pathway
salf00333  Prodigiosin biosynthesis
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SMD44_07458 (pps)
SSDB
Motif
Pfam: PPDK_N PEP-utilizers HHV-1_VABD
Other DBs
NCBI-ProteinID: ARX87972
UniProt: A0A1Z1WNU3
LinkDB
Position
complement(8125253..8128003)
AA seq 916 aa
MTTKTTTDSSPTAEATETPAPAPHTGLVAVLGRPHAATPEELGGKAARLDELTAAGLPVP
PAFCLTTALFDVFLRESGLAAEIRAAEARGASALTVRESVLARDIPEPVARTILAAYEDL
GRPRVAVRSSAPREDSAERSFAGQHDTVLDVSGDAALLDAVRVCWASLWSDRASAYRAGD
GPAGSIAVVVQEMVPADVSGVLFTVDPVGGRPNRLVVEACCGLGEGLVSGRVSSDFFVVD
DRTLDVVEERVRYKVTKCAPLAPGRIGMTKVDAADRDAPCLTRDQLAALARIALEIRDAG
GAEQDIEWAMHDGTLYLLQARPITTRPRPETSDGARSPYLPGLLERQPDAVRHGTLWSRM
DIGEIFVGLMSPLGLSFARHYQDHVHGDCAAALGVRDTGDVGLHMGFFQGHVYLNISYTA
YLLGQALPTRDQRHFTRRFVSEEVDLATYENPFGTFPGGLEDLLSTTHWLRATAGEMLVM
KDRARDMAESRLYEFDRARRLDLTRMGRRELHAELGRYLDYFHDAHVGYMPYYINAFGFY
GILTELCAKWLGAAGDNLQNRIKTDMSSLRTVASAQEIWSVAQAAKARPRVMEIIEAAPL
EEVADRLRADPDGEAFWQSQMEPFLRANGTRGRQEMELTHQRWIDDPSYVFQMIRRYAAD
GFTADDIMGRSRARQEGDVRAVLKKLPLPRRTTIEGVISMYALCSELREVTRMSMITSIW
LVRNVVYEVGRRLVEEGVLHSLDEVAFLDFADVRRWLAGGLPAREAFPRAAIEERRRVHE
YHNRLPEPPLTFVGEHDGTRAVRPVKDGARLDGLGSSPGRIVGRARIVEDLVWQADEFQA
GEILVTRHTDASWTPLFAIAGGVVTDIGSMLSHSSIVSREFNVPSVVNTKYATQVINTGD
MVMVDGDTGVVEVVEG
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgacgacgaagacgaccaccgattccagccccaccgccgaggccaccgaaacccctgcc
cccgccccgcacaccggcctcgtggccgtgctcggccgcccgcacgccgccacccccgag
gagctgggcggcaaggcggcccgcctcgacgagctgaccgccgcgggccttccggtgccg
cccgcgttctgcctgaccaccgccctcttcgacgtcttcctgcgcgagagcggcctcgcc
gccgagatccgcgccgccgaggcccgcggcgcatccgccctcaccgtccgcgagtcggtc
ctggcccgcgacatcccggagccggtcgcccgcacgatcctcgcggcgtacgaggacctg
ggccgcccccgggtcgcggtgcgctcctcggcgccgcgcgaggactccgccgagcggtcc
ttcgcgggccagcacgacacggtcctcgacgtgtcgggcgacgcggccctcctcgacgcg
gtcagggtctgctgggcctcgctgtggtcggaccgggcgtcggcctaccgggcgggagac
gggcccgcggggtccatcgccgtcgtggtgcaggagatggtgcccgccgacgtcagcggg
gtgctcttcacggtcgacccggtcggcggcaggccgaaccgcctggtggtggaggcctgt
tgcgggctcggcgagggcctggtgtccggcagggtgtccagcgacttcttcgtcgtggac
gaccgtacgctcgacgtcgtcgaggagcgcgtgcggtacaaggtcaccaagtgcgcgccg
ctcgcgcccggccgcatcggcatgacgaaggtcgacgccgccgaccgggacgccccctgc
ctgacccgggaccagctcgcggcgctcgcccggatcgccctggagatccgggacgccggc
ggcgcggagcaggacatcgagtgggcgatgcacgacggcacgctgtacctcctccaggcc
cgcccgatcaccacccggccccggcccgagacctccgacggcgcccgcagcccctatctg
ccgggcctgttggagcggcagccggacgccgtgcggcacggcaccctgtggtcgcggatg
gacatcggggagatcttcgtcggcctgatgtccccgctcggcctgagcttcgcccggcac
taccaggaccacgtccacggcgactgcgcggccgcgctcggcgtgcgcgacaccggcgac
gtcggcctgcacatgggcttcttccagggccacgtctatctgaacatctcctacaccgcg
tatctgctcggccaggccctgcccacccgcgaccagcgccacttcacccgccgcttcgtc
agcgaggaggtggacctggccacgtacgagaaccccttcgggacgttccccgggggcctg
gaggacctgctctcgacgacgcactggctgcgggccacggcgggcgagatgctggtgatg
aaggaccgcgcccgcgacatggccgaaagtcgcctttacgagttcgaccgcgcccggcgc
ctcgacctcacccgcatgggccgccgcgagctgcacgccgaactcgggcgctatctggac
tacttccacgacgcccacgtcggctacatgccgtactacatcaacgcgttcgggttctac
ggcatcctcaccgagctgtgcgccaagtggctcggcgccgcgggcgacaacctgcagaac
cgcatcaagacggacatgtcgagcctgcgtacggtggcgtcggcgcaggagatctggagc
gtcgcgcaggccgcgaaggccaggccgcgggtcatggagatcatcgaggcggcgccgctg
gaggaagtcgcggaccggctgcgcgcggaccccgacggcgaggcgttctggcagtcgcag
atggagccgttcctgcgtgccaacggcactcgggggcgccaggagatggagctcacccat
cagcgctggatcgacgacccgagctacgtcttccagatgatccgccgctacgccgccgac
ggcttcaccgccgacgacatcatgggccgcagccgcgcccgccaggagggcgacgtccgc
gcggtcctcaagaagctgccgctgccgcggcgcacgaccatcgagggcgtcatctcgatg
tacgccctgtgcagcgagctgcgcgaggtcacccgcatgtcgatgatcacgtcgatctgg
ctggtcaggaacgtggtgtacgaggtggggcggcgcctggtcgaggagggcgtgctgcac
tccctggacgaggtcgcgttccttgacttcgcggacgtgcgccgctggctggccggtggg
ctgcccgcgcgcgaggcgttcccgcgggccgcgatcgaggagcggcggcgcgtgcacgag
taccacaaccggctgccggagccgccgctgaccttcgtcggcgagcacgacggcacccgc
gcggtgcggcccgtgaaggacggggcgcggctcgacgggctcggctccagcccggggcgg
atcgtcggccgggcccgcatcgtggaggacctggtgtggcaggcggacgagttccaggcg
ggcgagatcctcgtgacccggcacaccgacgcctcctggacgccgctgttcgccatcgcg
ggcggcgtggtcaccgacatcggctcgatgctctcgcacagctccatcgtgtcgcgggag
ttcaacgtgccctcggtggtcaacaccaagtacgccacacaggtcatcaacaccggcgac
atggtcatggtcgacggcgacacaggtgtcgtcgaggtcgtggagggctga

DBGET integrated database retrieval system