KEGG   Streptomyces alboflavus: SMD44_07470
Entry
SMD44_07470       CDS       T05221                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
salf  Streptomyces alboflavus
Pathway
salf00333  Prodigiosin biosynthesis
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SMD44_07470
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: ARX87984
UniProt: A0A1Z1WNF4
LinkDB
Position
8146132..8147529
AA seq 465 aa
MTTDRAPAPGAPAAPATATSASASAASATSASASAASASADFADALREAARIAVLSPSSH
NCQPWAVAWARSEVSRAAAARVVEGEAGASGVSRVAEGPGGGRGDGADEAYQYLVLGLDR
DRELRSLPAHAVEMLLSCGLYWQLLLRALEAQGWSVDALRFADGPLDPGAVRGAELPGTS
WPRSWTALCVARLRGRAGAGAEARGAAGGEVGSGAQDGGAELRTLRAAARARRTNRAPYR
PQPVRPALLDGLLVPSGCAAARGADVTVRHLTSGADRDAFADFVAEHGGRDFSHREAWRE
TYAFLRADRAEAAARGDGFALDQLFGPLSWPSRQALRAALAPATMRLLAPVGYDRFVGRR
LAHGLARMVRPTPAVVAMSFDRTEPTLADAVKGGARLADYWLCATAAGLALHPVSIVLQH
EDLRTAFQSSLRIPGRAFFVSRLGLPVTEFPRSPRRPAVAHLRRI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaccacagaccgggccccggcccccggcgcccctgccgcacccgcgaccgccacctcc
gcctccgcttccgctgcctccgccacctccgcctccgcttccgctgcctccgcctccgcc
gatttcgccgacgccctgcgcgaggcggcccggatcgccgtgctcagcccctcgtcccac
aactgccagccgtgggcggtggcgtgggccaggagcgaggtgtcgcgggccgccgccgcg
cgggtggtggagggggaggccggggcgtccggggtgtcccgggtggccgagggtcccggg
ggcgggcgcggcgacggggcggacgaggcgtatcagtacctcgtcctcgggctcgaccgt
gaccgggagctgcggtcgctgcccgcccacgccgtcgagatgctgctcagctgcggcctg
tactggcagttgctgctgcgggccctggaggcgcagggctggtcggtggacgccctgcgg
ttcgccgacggcccgttggacccgggggcggtgcgcggcgccgagctgcccgggaccagc
tggccccggtcgtggacggcgctgtgcgtggcgcggctgcgcggccgggcgggggcgggg
gccgaagcccggggcgcggccgggggcgaagtaggctccggcgcccaggacggcggcgcg
gagctgcgtaccctgcgcgccgccgcccgcgcccgccgcaccaaccgcgccccctaccgc
ccccagcccgtccggcccgccctcctggacggcctgctcgtcccctcggggtgcgcggcg
gcacgcggcgccgacgtgaccgtgcggcatctgacgtccggcgccgaccgtgacgcgttc
gccgacttcgtggccgagcacggcggccgcgacttcagccaccgcgaggcctggcgcgag
acgtacgcgttcctgcgggccgaccgggccgaagccgccgcgcgcggcgacggcttcgcc
ctcgaccagctcttcgggccgctgtcgtggccgagcaggcaggcgctgcgtgccgccctc
gcgcccgcgacgatgcggctgctcgcccccgtcggctacgaccgcttcgtcggccgccgc
ctcgcccacgggctcgcccggatggtgcggccgacgcccgctgtggtcgccatgagcttc
gaccggacggagccgacgctcgccgacgccgtcaagggcggagcgcgactggccgattac
tggctgtgcgcgaccgcggccgggctcgccctgcatcccgtgagcatcgtactccagcac
gaagatctgcggacggccttccagtcgagcctccgcattccggggcgcgcgttcttcgtg
agccgcctcggcctgcccgtcaccgagttcccgcgctccccacgccgccctgccgtcgca
cacctgcggaggatctga

DBGET integrated database retrieval system