KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_09335
Entry
L593_09335        CDS       T02693                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family protein
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00053  Ascorbate and aldarate metabolism
sali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    L593_09335
Enzymes [BR:sali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     L593_09335
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind GDP_Man_Dehyd NAD_binding_10 3Beta_HSD Polysacc_synt_2 NAD_binding_4
Other DBs
NCBI-ProteinID: AGN01812
UniProt: R4W5M0
LinkDB
Position
complement(2057376..2058200)
AA seq 274 aa
MHVAITGAAGQIGEIAREAFEPAERTLFTHSEHEGLDATVLEVTDREAVGAALADAGADV
LLHLAWGPAGRDDWEDGHASNLEGTIDVLEAAVEHDLDRVVLASSIHAVGMYNRERADEM
ESLVAEPATVIGPDDPPRPDSYYGVAKVACEAMGRYYADRYDLEVVPLRIGWVCDREELR
AVATAASSESDRARGRFARATWLSPRDCRAVCEAAVRADLGPAMTPGRPLPAISANADRF
QTLAPTMRAIGYRPRDDAAAVLDKAERGGTAEEG
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcacgtcgccatcaccggcgctgccgggcagatcggtgagatcgcccgcgaggccttc
gagccagccgaacggacgctgttcacccacagcgaacacgaggggctcgacgccactgtc
ctcgaggtcaccgatcgcgaggcagtcggcgccgccctggccgacgccggtgcggacgtg
ctcctccacctcgcctgggggccagccgggcgcgacgactgggaggacggccacgccagt
aacctggagggaacgatcgacgtgctggaggccgccgtcgagcacgacctcgatcgggtc
gtactcgccagttcgatccacgcggtcgggatgtacaaccgcgagcgcgccgacgagatg
gagtcgctcgtcgcggaacccgccaccgtgatcggccccgacgatccaccgcggcccgac
tcctactacggcgtcgcgaaggtcgcctgcgaggcgatgggccgatactacgcggatcga
tacgacctggaagtcgtgcccctccggatcggctgggtttgcgatcgcgaggaactccgg
gcggtcgcaacggcggcttcgagtgagtcggaccgggctcgcggccgcttcgccagggcg
acctggctgagtccccgggactgtcgggcggtctgtgaggcagcggtgcgggcggatctc
gggcccgcgatgacccccggacggccgctcccggcgatctccgcgaacgccgaccggttc
cagacgctcgccccgacgatgcgagcgatcggctatcggccgcgcgacgacgcggcagca
gtgctggacaaagcggagcgcggcggcaccgccgaggaggggtaa

DBGET integrated database retrieval system