Salvelinus sp. IW2-2015 (Arctic char): 111952380 Help Entry 111952380         CDS       T05762                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp04010   MAPK signaling pathway salp04012   ErbB signaling pathway salp04068   FoxO signaling pathway salp04137   Mitophagy - animal salp04140   Autophagy - animal salp04144   Endocytosis salp04150   mTOR signaling pathway salp04210   Apoptosis salp04218   Cellular senescence salp04370   VEGF signaling pathway salp04371   Apelin signaling pathway salp04510   Focal adhesion salp04540   Gap junction salp04625   C-type lectin receptor signaling pathway salp04810   Regulation of actin cytoskeleton salp04910   Insulin signaling pathway salp04912   GnRH signaling pathway salp04916   Melanogenesis salp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:salp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111952380    04012 ErbB signaling pathway     111952380    04370 VEGF signaling pathway     111952380    04371 Apelin signaling pathway     111952380    04068 FoxO signaling pathway     111952380    04150 mTOR signaling pathway     111952380  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111952380    04140 Autophagy - animal     111952380    04137 Mitophagy - animal     111952380   09143 Cell growth and death    04210 Apoptosis     111952380    04218 Cellular senescence     111952380   09144 Cellular community - eukaryotes    04510 Focal adhesion     111952380    04540 Gap junction     111952380   09142 Cell motility    04810 Regulation of actin cytoskeleton     111952380  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111952380   09152 Endocrine system    04910 Insulin signaling pathway     111952380    04912 GnRH signaling pathway     111952380    04916 Melanogenesis     111952380  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111952380  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:salp04131]     111952380   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:salp04147]     111952380    04031 GTP-binding proteins [BR:salp04031]     111952380 Membrane trafficking [BR:salp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     111952380  Endocytosis   Macropinocytosis    Ras GTPases     111952380 Exosome [BR:salp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111952380   Exosomal proteins of colorectal cancer cells    111952380 GTP-binding proteins [BR:salp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111952380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha DUF6974 Motif Other DBs NCBI-GeneID:  111952380 NCBI-ProteinID:  XP_023826756 LinkDB All DBs Position LG26:complement(30197322..30231070) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagtgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaaatcctttgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc ccggcgtgtaccgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system