KEGG   Streptomyces albus: SLNWT_4972
Entry
SLNWT_4972        CDS       T03823                                 
Name
(GenBank) secreted protein
  KO
K14628  enoyl reductase
Organism
sals  Streptomyces albus
Pathway
sals01057  Biosynthesis of type II polyketide products
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SLNWT_4972
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sals01008]
    SLNWT_4972
Polyketide biosynthesis proteins [BR:sals01008]
 Polyketide tailoring proteins
  Others
   SLNWT_4972
SSDB
Other DBs
NCBI-ProteinID: AJE85348
UniProt: A0A0B5ERC4
LinkDB
Position
5804668..5805705
AA seq 345 aa
MPAMSRWHRAIAVVSLTGLAVAVPGVAQAGGRGGHGNVGGTRQGGGAGGDGTLSATAGGI
VWDRSHNGTGKKVSAVTPLGDWNPPACWYAPAYTPEQLRKKLEPIWGAGSTGAEWDSSQR
DRYVNGKPYQDFNKKKAGKGFWWDSFVAEGRAADPGAADCDKPYFWVDKGDPPPADIPEA
LTPEMLAKLAYREIRVPGTEVELAPADRTKVNLPTWAWLDKAEFKPVSVTASVPALDIRA
TTTAEPVSLKIEPGTEDAVLHPASGTCPITDGRIGTPFTKGSAQKKPPCGLTYLRSSGGD
AYTLRATLTWKIHWTGTGVPGGALPDGAFGAEQDITVQEIQSVNR
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgccggccatgagcagatggcacagagcgatcgcggtcgtctcgctgaccggcctcgcc
gtcgcggtaccgggggtcgcccaggcgggcggccgcggcgggcacggcaatgtcggcggg
acccggcagggcggcggcgccggtggcgacggcaccctgtcggccaccgccgggggcatc
gtctgggaccgctcccacaacggcaccggcaagaaggtcagcgcggtcaccccgctcggc
gactggaacccgcccgcctgctggtacgcgcccgcctacacaccggagcagctgcggaag
aagctggagccgatctggggggccggttccaccggcgccgagtgggactcctcgcagcgc
gaccggtacgtcaacggcaagccctaccaggacttcaacaagaagaaggccgggaagggc
ttctggtgggacagcttcgtcgccgaggggcgggcggccgatcccggcgcggccgactgc
gacaagccgtacttctgggtggacaagggcgatccgcccccggccgacatccccgaggcc
ctcacacccgagatgctcgccaagctcgcctaccgcgagatccgggtgcccggcaccgag
gtggaactggcccccgccgacaggaccaaggtgaatctccccacctgggcctggctcgac
aaggccgagttcaagccggtctcggtcacggcctcggtccccgccctggacatccgggcc
accaccaccgccgagccggtctccctgaagatcgagccgggcaccgaggacgccgtcctg
cacccggcctccggtacgtgcccgatcacggacggccggatcggcaccccgttcaccaag
ggcagcgcccagaagaagccgccgtgcggactgacctacctccgctcctccggcggggac
gcctacaccctccgggccaccctcacctggaagatccactggaccggcaccggcgtaccc
ggcggcgccctccccgacggcgccttcggggccgagcaggacatcaccgtccaggagatc
cagtccgtcaaccgttag

DBGET integrated database retrieval system