KEGG   Streptomyces alboniger: CP975_24835
Entry
CP975_24835       CDS       T06908                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
salw  Streptomyces alboniger
Pathway
salw01100  Metabolic pathways
salw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP975_24835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:salw01008]
    CP975_24835
Polyketide biosynthesis proteins [BR:salw01008]
 Polyketide tailoring proteins
  Others
   CP975_24835
SSDB
Other DBs
NCBI-ProteinID: QEV20333
UniProt: A0A5J6HPC3
LinkDB
Position
complement(5517300..5518289)
AA seq 329 aa
MAATLLLSAPAPARTGHGGTTNGDAKGPTEDGGDGSLTASAGGISYDRSKNGKGPKTGAI
APAGAYSPPPCWYGPAYTPAQFKKEREAVWAVDSTGHQWDLAQRKRYVEGEPYKNFNLDK
AGKGYWWTGFPNPTYPPGWDKCDKETFWVDENEPPPPGLPAIDPETLAKLAYAEIRVPGT
KVTLAPEAETKVNLPTWAWLDGAEFKPVSVTARVDVLDIEATTTAEPVSLKIDPGTPDAE
TYPESGVCEIVDGKIGEPYAKGRSKQDPPCGVKYLRSSGDGSYPLKATVTWKISWTGTGV
DGAKQLPDGEFGAEQDVVVQEIQAINRQA
NT seq 990 nt   +upstreamnt  +downstreamnt
atggccgcgacgctgctcctgtcggcacccgccccggcccgcacgggccacggcggcacc
accaacggtgacgccaagggtcccaccgaggacgggggcgacggctccctgacggcctcg
gccggcggcatcagctacgacaggtccaagaacggcaagggccccaagaccggcgccatc
gcccccgcgggcgcctacagcccgccgccgtgctggtacggccccgcctacacccccgcc
cagttcaagaaggagcgcgaggcggtctgggcggtggactccacgggacaccagtgggac
ctggcgcagcgcaagcgttacgtcgagggcgagccgtacaagaacttcaacctcgacaag
gccggcaagggctactggtggactggcttccccaaccccacgtatccgcccggctgggac
aagtgcgacaaggagaccttctgggtcgacgagaacgagccgccgccccccggcctcccc
gccatcgacccggagaccctggcgaagctggcgtacgccgagatccgcgtacccggcacc
aaggtgaccctggcccccgaggccgagacgaaggtgaacctccccacctgggcctggctc
gacggcgcggagttcaagccggtgtcggtcacggccagggtcgacgtactcgacatcgag
gcgacgacgaccgccgaaccggtctccctgaagatcgaccccggcacgccggacgccgag
acgtacccggaatccggcgtctgcgagatcgtcgacggcaagatcggagagccgtacgcc
aagggcaggtccaagcaggacccgccctgcggcgtgaagtacctgcgctcctcgggcgac
ggctcgtacccgctgaaggcgacggtgacctggaagatcagctggacggggacgggcgtg
gacggggcaaagcagctccccgacggcgagttcggcgcggagcaggacgtggtcgtgcag
gagatccaggccatcaaccgccaggcatga

DBGET integrated database retrieval system