KEGG   Streptomyces ambofaciens: SAM23877_5622
Entry
SAM23877_5622     CDS       T04055                                 
Symbol
srm15
Name
(GenBank) putative NDP-hexose aminotransferase
  KO
K19854  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase [EC:2.6.1.89]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00523  Polyketide sugar unit biosynthesis
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01250  Biosynthesis of nucleotide sugars
Module
samb_M00796  dTDP-D-mycaminose biosynthesis
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAM23877_5622 (srm15)
Enzymes [BR:samb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.89  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase
     SAM23877_5622 (srm15)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP BAMBI
Other DBs
NCBI-ProteinID: AKZ58667
UniProt: A0A0K2B0Q2
LinkDB
Position
complement(6006202..6007368)
AA seq 388 aa
MTIPFLDAGAGYRELRAEIDAALQRVSASGRYLLDAELAAFEEEFAAYCDNDHCVAVGSG
CDALELSLRALDIGPGDEVVVPAHTFIGTWLAVSATGARPVAVDPTPDGLSLDPALVEAA
LTPRTRALMPVHLHGHPADLDPLLAIAGRHGLAVVEDAAQAHGARYRGRRIGSGHVVAFS
FYPGKNLGAMGDGGAVVTGDSGVAERIRLLRNCGSREKYRHEVRSTHSRLDEFQAAVLRA
KLPRLDAWNARRAGTAERYGRALGPVPQIAVPVTAPWADPVWHLYVIRCAERDELRRRLE
RAGVQTLIHYPVPPHRSPAYADDPAGAPAGTHPLSERLAAQSLSLPLGPHLGEDEARAVV
AAVRAASAGLAAYPTPDGQRFPLVTEKR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaccatccccttcctcgacgcgggcgccggctaccgggagttgcgagccgagatcgac
gcggccctgcagcgggtgtccgcctccggccgctatctgctcgacgcggaactcgcggcc
ttcgaggaggagttcgccgcgtactgcgacaacgaccactgtgtggcggtgggcagtggc
tgcgacgcgctggagctgtccctgcgggcgctggacatcggtcccggggacgaggtggtg
gtgcccgcgcacaccttcatcgggacctggctggccgtgtccgctaccggggcacggccg
gtggccgtcgacccgacgccggacgggctctccctcgacccggcgctggtggaggcggcg
ctcacccctcggaccagagccctgatgccggtgcacctgcacgggcacccggccgacctc
gacccgctactggcgatcgccggacggcacggcctggccgtggtcgaggacgccgcgcag
gcccacggcgcccgttaccggggccgcaggatcggctcgggccacgtggtcgcgttcagc
ttctaccccggcaagaacctcggcgccatgggggacggcggcgcggtggtcacgggtgac
tccggtgtggccgagcggatccggttgctgcgcaactgcggctcgcgggagaagtaccgg
cacgaggtgcgctcgacccactcccggctcgacgagttccaggcggccgtgctgcgggcc
aaactgccgcggctcgacgcgtggaacgcccgccgggccggcacggccgaacggtacggg
cgggccctgggtccggtaccgcagatcgccgtcccggtcaccgctccctgggccgacccg
gtgtggcacctgtacgtgatccgctgcgcggagcgcgacgagctgcgccgccggctggaa
cgagccggggtccagaccctgatccactaccccgtgcccccgcaccggtccccggcctac
gccgacgacccggccggcgcaccggcggggacccacccgctcagtgagcgcctggcggcg
cagagcctcagccttcccctgggaccgcacctcggggaggacgaggcccgcgccgtcgtg
gcggcggtccgggcggcgtccgcagggctggcggcgtacccgacgccggacggccagcgt
tttcctctagtgacggagaaacgatga

DBGET integrated database retrieval system