Streptococcus anginosus C1051: SAIN_0762 Help Entry SAIN_0762         CDS       T02828                                  Name (GenBank) putative chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism sang  Streptococcus anginosus C1051 Pathway sang00400   Phenylalanine, tyrosine and tryptophan biosynthesis sang01100   Metabolic pathways sang01110   Biosynthesis of secondary metabolites sang01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:sang00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     SAIN_0762 Enzymes [BR:sang01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      SAIN_0762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Lge1 Osmo_CC Motif Other DBs NCBI-ProteinID:  AGU81511 LinkDB All DBs Position 794604..794867 Genome browser AA seq 87 aa AA seqDB search MDLAEIRKEIDQIDVDLITLLEKRMALVSQVALYKRQTGKAVLDTQREQIILEKVANSVQ EKQYEDTLVQTFSDLLKHSRAYQERHI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggatttagcagaaattagaaaagaaattgatcaaatagatgtagacttgattaccttg ttagagaaaagaatggcgttagtgagccaagtagctctttacaagcgtcagaccgggaaa gcagtattggatactcagcgtgagcaaattattttagagaaagttgcaaatagtgtgcag gaaaaacagtatgaagacacccttgtgcagactttttcagatcttttaaaacattcacgt gcttatcaagagcggcatatctaa

DBGET integrated database retrieval system