Sinocyclocheilus anshuiensis: 107668451 Help Entry 107668451         CDS       T04917                                  Name (RefSeq) core histone macro-H2A.1-like   KO K11251   histone H2A Organism sanh  Sinocyclocheilus anshuiensis Pathway sanh03082   ATP-dependent chromatin remodeling sanh04217   Necroptosis Brite KEGG Orthology (KO) [BR:sanh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107668451  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107668451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sanh03036]     107668451   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sanh04147]     107668451 Chromosome and associated proteins [BR:sanh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107668451 Exosome [BR:sanh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107668451 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Clp_N Cdc6_lid Motif Other DBs NCBI-GeneID:  107668451 NCBI-ProteinID:  XP_016315805 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSSRGGKKKISKTSRSAKAGVIFPVGRMLRYIKRGLPKYRIGVGAPVYMAAVLEYLTAEI LELAGNAARDNKKGRVTPRHILLAIANDEELHQIMPEEKLDIR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccagtcgaggtgggaagaagaagatctccaagacgtccaggtctgctaaggctggt gtgatcttccctgtgggacggatgctgcgctatattaaaagagggcttcccaaatacagg attggtgttggagctccagtctacatggctgcagtactggagtacctgacagctgaaatc ctggagctggcaggcaatgcagccagagacaataagaagggccgcgtcacacccagacac attttactagccatcgccaatgatgaggagcttcatcagataatgccagaggaaaaactg gacatacgctaa

DBGET integrated database retrieval system