KEGG   Streptomyces aureoverticillatus: G3H79_04225
Entry
G3H79_04225       CDS       T08343                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
saov  Streptomyces aureoverticillatus
Pathway
saov00333  Prodigiosin biosynthesis
saov01100  Metabolic pathways
saov01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saov00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G3H79_04225
SSDB
Motif
Pfam: Thioesterase Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Hydrolase_4
Other DBs
NCBI-ProteinID: QIB42399
LinkDB
Position
1283570..1284415
AA seq 281 aa
MPLTERTQAPAEPARAWFTGPGFGPGPQPTGTEAAPTGPRLICFSYAGGTPSVYRDWPDL
LGPGVTVVPVLLPGRGLRLGEAPYTDMAPLARDVTDALLAAGHVHDHYALFGHSMGALLA
YEVACELRERGRPGPRHVFVSGSRAPHLYDGPDGQGLGDDDLRQLVHELGALGSGDEVGR
FYLERRLPVLRADLTLCARYRWRPRRPLDCPMTAFSAAGDPIAPRAHVEAWRAYTSASLL
HRRVPGGHFYLNGPARLPLLRELRAELTRTAPKEREPSWIC
NT seq 846 nt   +upstreamnt  +downstreamnt
gtgcccctcaccgagcgcacgcaggcaccggccgaaccggcccgcgcctggttcaccggc
cccggcttcgggccaggaccgcaacccaccggaacggaggccgcccccaccggcccccgc
ctgatctgcttcagctacgcgggcggcaccccctccgtctaccgcgactggccggacctg
ctcggccccggcgtcaccgtcgtaccggtgctgcttccggggcgcgggctgcggctcggc
gaggcgccgtacaccgacatggcgccgctggcccgcgacgtgaccgacgcgctgctcgcc
gccggacacgtacacgaccactacgccctgttcgggcacagcatgggcgcgctgctcgcc
tacgaggtcgcctgcgagctgcgggagcgggggcggccggggccccggcacgtgttcgtg
tccggcagcagggcgccgcacctgtacgacggcccggacggccaggggctcggcgacgac
gacctgcgtcaactcgtccacgaactcggcgcgttgggatccggcgacgaggtgggccgc
ttctacctggagcgcaggctgccggtgctgcgcgccgacctcaccctctgcgcccgctac
cgctggcggccgcgccgcccgctcgactgcccgatgaccgcgttctccgccgcgggcgac
ccgatcgcaccccgcgcccacgtcgaggcgtggcgcgcgtacacctccgcctcgctgctg
caccgcagggtgccgggcggccacttctacctgaacggacccgcacggcttccgctcctt
cgtgagctgcgcgccgaactcacccgtaccgcccccaaggagagggaaccctcatggatc
tgctga

DBGET integrated database retrieval system