KEGG   Streptomyces aureoverticillatus: G3H79_22930
Entry
G3H79_22930       CDS       T08343                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
saov  Streptomyces aureoverticillatus
Pathway
saov01057  Biosynthesis of type II polyketide products
saov01100  Metabolic pathways
saov01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saov00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    G3H79_22930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saov01008]
    G3H79_22930
Polyketide biosynthesis proteins [BR:saov01008]
 Polyketide tailoring proteins
  Others
   G3H79_22930
SSDB
Other DBs
NCBI-ProteinID: QIB45497
LinkDB
Position
5666015..5667049
AA seq 344 aa
MPGVSRKHWPTVGAVAMASALLLQGPAWAEYGHGGSTNGKPPASGNAKDDVLSAEAGAVV
YDRSKNGTGAKTGAVTAAGDWSPPPCWYAPRYTAAQFKKEREAVWGVGSTGHEWDTQQRK
RYVEGHPYKNFNLDKADKGYWWSSYPNKSYPPGWDKCDKETFWVDKGDPPPADVPEAITT
EMLAHLAYAEIRVPGTKVAMAPEGGTKVNLPTWTWLDGAEFKPVSVTASVPVLGIQATTT
AEPVSLKIDPGTKDARTYPASGVCPLGDNDRIGEPYAKGKAKETPPCGVKYLRSSGDGSY
PLKATVTWKIHWTGTGTDGEQPLPDGEFGADQDVVVQEIQAINR
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgccaggagtgagccgcaagcattggccgaccgtaggggccgtcgcgatggcgtccgcc
ctgcttctgcaggggccggcctgggccgagtacggacacggcggaagcaccaacggcaaa
ccgccggcgtccggcaacgcgaaggacgacgtgctgtccgccgaggcgggcgccgtcgtc
tacgaccgttccaagaacggcaccggcgccaagaccggtgccgtgacggctgccggcgac
tggtcgccgcccccctgctggtacgccccgcgctacaccgccgcccagttcaagaaggag
cgcgaggcggtctggggcgtcggctcgacggggcacgagtgggacacgcagcagcgcaag
cggtacgtcgaggggcacccgtacaagaacttcaacctcgacaaggccgacaaggggtac
tggtggtcctcgtaccccaataagtcctatccgcccggctgggacaagtgcgacaaggaa
accttctgggtggacaagggcgacccgcccccggccgacgtgcccgaggcgatcaccacg
gagatgctcgcccacctcgcgtacgccgagatccgcgtgccggggacgaaggtggccatg
gcccccgagggcggcaccaaggtcaacctgccgacctggacctggctggacggcgccgag
ttcaagccggtgtccgtgacggcctccgtgcccgtactcggcatccaggccacgaccacc
gccgagcccgtctccctgaagatcgaccccggcaccaaggacgcccggacctacccggcc
tccggcgtatgccccctgggcgacaacgaccgcatcggcgagccctacgccaagggcaag
gcgaaggagaccccgccgtgcggcgtgaagtacctgcgctcgtccggcgacgggtcgtac
cccctgaaggccaccgtcacctggaagatccactggactgggacgggcaccgacggggaa
cagccgctgcccgacggggagttcggcgccgatcaggatgtcgtggtgcaggagattcag
gcgatcaaccgctga

DBGET integrated database retrieval system