Sulfobacillus acidophilus DSM 10332: Sulac_0664 Help Entry Sulac_0664        CDS       T01746                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism sap  Sulfobacillus acidophilus DSM 10332 Pathway sap03030   DNA replication sap03430   Mismatch repair sap03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sap00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Sulac_0664    03430 Mismatch repair     Sulac_0664    03440 Homologous recombination     Sulac_0664  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sap03032]     Sulac_0664    03400 DNA repair and recombination proteins [BR:sap03400]     Sulac_0664    03029 Mitochondrial biogenesis [BR:sap03029]     Sulac_0664 DNA replication proteins [BR:sap03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Sulac_0664 DNA repair and recombination proteins [BR:sap03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Sulac_0664   TLS (translesion DNA synthesis) factors    Other SOS response factors     Sulac_0664 Mitochondrial biogenesis [BR:sap03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Sulac_0664 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon RcpC Motif Other DBs NCBI-ProteinID:  AEW04174 UniProt:  G8U005 LinkDB All DBs Position 671751..672140 Genome browser AA seq 129 aa AA seqDB search MLNQVTLIGRLTRDPEVRYAQNGKAVAGFSVAVDRPVANADGKRDADFIDCVAWDKLGET VGNHLTKGRLVAVEGRLQIRSYEAQDGTKRRVTEVVCRNVQFLDAPKKAQSSESGPAPAD EELPDDLPF NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgttaaaccaagtgacgttgattggccgcttgacccgggacccggaggtgcggtacgcc caaaacggcaaggcggtggccggcttttcggtcgccgtggaccggccggtggcgaacgcc gacggcaagcgcgacgccgacttcatcgactgtgtggcgtgggacaaactcggggaaacc gtgggcaaccacttgacgaaggggcggttggtggccgtggaagggcggctacagattcgg tcgtacgaggcccaagacgggacgaagcggcgggtgaccgaggtggtgtgccggaacgtg cagtttctcgatgcgccgaagaaggctcagagctccgagagtggtccggccccggccgac gaagagctcccggatgacctgccgttctaa

DBGET integrated database retrieval system