KEGG   Salinispora arenicola: Sare_2028
Entry
Sare_2028         CDS       T00613                                 
Name
(GenBank) O-methyltransferase family 2
  KO
K21255  orsellinic acid C2-O-methyltransferase [EC:2.1.1.-]
Organism
saq  Salinispora arenicola
Pathway
saq01059  Biosynthesis of enediyne antibiotics
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Module
saq_M00833  Calicheamicin biosynthesis, calicheamicinone => calicheamicin
saq_M00834  Calicheamicin orsellinate moiety biosynthesis, malonyl-CoA => orsellinate-ACP => 5-iodo-2,3-dimethoxyorsellinate-ACP
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sare_2028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saq01008]
    Sare_2028
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     Sare_2028
Polyketide biosynthesis proteins [BR:saq01008]
 Polyketide tailoring proteins
  Methylase
   Sare_2028
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_25 HTH_IclR Methyltransf_12 MTS Methyltransf_31
Other DBs
NCBI-ProteinID: ABV97898
UniProt: A8LZN5
LinkDB
Position
complement(2318524..2319588)
AA seq 354 aa
MPPTTSNPQPGLRHRMQHLVYGFFTAQTLHVAARLRIPDLLADGKADVAALAEATDTHAP
SLRRLLRALVFLEVLEEPEPGIFVLTEQGGLLRSDAIGSMRELVLLLSGPESWAAWGQLE
HGVRTGEVAWEHAHGQSCFAYLAANPQRQAAFNAAMAEGSRAFVPMLMSAYDFSDLETVV
DVGGGSGDLLAGLLAAHPRLRGTVFDTPDGVADTARTLTAQGVADRCTVWSGDFFQSVPS
GADAYLLKSVLHDWDDERCVAVLRTVHRATRRDSRILLVESVMPPIVGTSPSVAQVVMND
LNMMVCHGGRERTVAEFQELLRTAGFQLDSVAPCPAPSVMCVLEATPVTDGTQP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgccaccgaccacgagcaatccccagcccgggctgcggcaccggatgcaacacctggtc
tacgggttcttcaccgcccagacgctgcacgtcgccgcccggctccggataccggacctg
ctcgccgacggcaaggccgacgtcgccgcgctggccgaggccaccgacacgcacgcacca
tcgctgcgtcggctcctccgggcgctggtgttcctggaggtgctcgaggagccggagccc
ggcatcttcgtcctcaccgaacagggcgggttgctccggtcggacgccatcgggtcgatg
cgggaactggtgctgttgctctccgggccggagagctgggccgcctgggggcagctcgaa
cacggcgtccgcaccggcgaggtggcctgggagcatgcgcacggacagagctgtttcgcg
tacctcgccgcgaacccccagcggcaggcggcgttcaacgcggccatggcggaaggttcc
cgggcgttcgtgccgatgctgatgtccgcgtacgacttctccgacctggaaaccgtggtg
gacgtcggcggcggcagtggggatctgctggccgggctgctcgccgcgcacccgcggctg
cggggcacggtcttcgacacccctgatggcgtggccgacaccgcgcgcacgctcaccgcg
cagggcgtggccgaccggtgcacggtctggtccggggacttcttccagtcggtgccatcc
ggcgcggacgcctacctgctcaagagcgtcctgcacgactgggacgacgagcggtgcgtg
gccgtgctgcgtaccgtccaccgtgcgacccgccgggacagccggatcctgctcgtggag
tccgtcatgccaccgatcgtcggcaccagcccgagcgtcgctcaggtggtcatgaacgac
ctgaacatgatggtgtgccacggcggccgggaacgcaccgtggccgaattccaggagctg
ttgcgcacggcgggcttccagctggattcggtcgcaccctgcccggcaccgagcgtgatg
tgcgttctggaggcgacgccggtgacggacggaacgcagccatga

DBGET integrated database retrieval system