KEGG   Salinispora arenicola: Sare_4933
Entry
Sare_4933         CDS       T00613                                 
Name
(GenBank) AMP-dependent synthetase and ligase
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
saq  Salinispora arenicola
Pathway
saq01059  Biosynthesis of enediyne antibiotics
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Module
saq_M00830  Neocarzinostatin naphthoate moiety biosynthesis, malonyl-CoA => 2-hydroxy-5-methyl-1-naphthoate => 2-hydroxy-7-methoxy-5-methyl-1-naphthoyl-CoA
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sare_4933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saq01008]
    Sare_4933
Enzymes [BR:saq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     Sare_4933
Polyketide biosynthesis proteins [BR:saq01008]
 Polyketide tailoring proteins
  Others
   Sare_4933
SSDB
Motif
Pfam: AMP-binding AMP-binding_C GH3
Other DBs
NCBI-ProteinID: ABW00681
UniProt: A8LW76
LinkDB
Position
5599143..5600810
AA seq 555 aa
MPPTAVHPTRTGTVPWPAEVATRYLAEGYWAGRPLGAYLTAAARANPAAIALVDGDLRLS
YRELMSRADGAAARLVERGVSGDDRVVVQLPNCWEHIVLTVACLRLGAVPVWALPEHRLR
EITGVAARAEARVLVVPARHREFDHRAMAHEVAATVPSIEHVLVTGSADPGEDLGRLCEP
AADPAALSARFDAAAPDATAVATFLLSGGTTGTPKLVPRTHNDLAYMVGEAARLCEFGPD
TAYLAALPLGHGFPYTGPGVLGALMSGGRVVIAASPAPGPALATIERERVTATSIVPAIA
LRWLAHHAAHPGRDLGSLRLVQIGAARLEPDAAARIEPELGGRLQQVFGMGEGLLCLTRL
DDPPAVVHHTQGRPISPADEVLIVDDEDQPVRPGEAGALLTRGPYTLRGYYRSPEIDAAS
FLADGWYRTGDIVRQTPDGNLVVTGREKDLINRGGEKVSAVEVEGFALALDGVTQAAAMA
MSDAELGERVCLFVVPAGGARVDLADVRASMLDRGVAAFKLPDRLVSVDALPMTPLGKID
KKALRDQIPTHLDTA
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgccgccgaccgcggttcacccgacccgtacgggaaccgttccctggcccgccgaggta
gccacgcgctacctcgccgagggttactgggcgggccgacccctgggggcgtacctcacc
gctgccgctcgcgcgaacccggccgcgatcgcactggtcgacggcgatctgcggctgagc
taccgggagctgatgtcccgcgccgacggcgctgcggcccggctcgtcgagcgtggcgtc
agcggcgacgaccgggtcgtggtgcagttgccgaactgctgggagcacatcgtgctcacc
gtggcctgcctgcgactcggcgccgtcccggtgtgggctctgccggagcaccgactgcgc
gaaatcaccggcgtcgccgcccgcgccgaggcccgggtactggtagtacccgcccggcat
cgcgagttcgaccacagggcgatggcgcacgaggtggccgccaccgtacccagcatcgag
cacgtcctggtgaccggatccgcagatccaggtgaggatctgggcaggctgtgtgagccg
gcagcagaccccgccgcgctgtccgcacgcttcgacgcggctgcgccggatgctaccgcg
gtggcgacgttcctgctctccggcggcaccaccggcacgcccaaactcgtgccccgaacg
cacaacgacctcgcctacatggtcggcgaggcagcccgactgtgcgagttcggtccggac
acggcgtatctcgcggctcttccgctcggccacggattcccgtacaccggtccgggtgtt
ctgggcgcgctgatgtccggcggccgggtggtcatcgccgcctcccccgcccccgggccg
gcgttggcgacgatcgaacgcgagcgggtcaccgcgacgtcgatcgtcccggcgatcgcg
cttcgttggttggcgcaccacgcggcccaccccggccgggacctgggttccctgcgtctg
gtgcagataggggcggcacgtctggagcccgacgccgcggcccggatcgagcccgagctg
gggggacggctgcagcaggtgttcgggatgggggagggtctgctctgcctgacccgcctg
gacgatccgccggcagtcgtgcaccacacccagggccggccgatcagccccgccgacgag
gttctcatcgtcgacgacgaggaccagccggtgcggccgggggaggcgggggcgctactc
acccgcggcccgtacacccttcgcggctactaccgctcgcccgagatagacgcggcgtcc
ttcctggctgatggttggtaccgaaccggcgacatcgtccgccagacgccggacgggaac
ctggtggtcaccggccgcgagaaagatctgatcaaccgtggtggtgagaaggtcagcgcc
gtcgaggtcgagggtttcgcgctcgctctcgacggggtcacccaggcagccgccatggcg
atgtcggacgccgaactcggtgaacgcgtatgcctgttcgtcgtccccgcgggtggggcg
cgggtggacctggcagacgtgcgtgcctcgatgctcgaccgcggcgtcgcggcgttcaag
ctgccggaccgactggtcagcgtggacgcgctgccgatgacaccactcggcaaaatcgac
aaaaaggcattgcgggaccagatcccgacgcacctggacactgcctga

DBGET integrated database retrieval system