KEGG   Streptomyces aquilus: EJC51_31075
Entry
EJC51_31075       CDS       T07011                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
saqu  Streptomyces aquilus
Pathway
saqu01057  Biosynthesis of type II polyketide products
saqu01100  Metabolic pathways
saqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saqu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    EJC51_31075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saqu01008]
    EJC51_31075
Polyketide biosynthesis proteins [BR:saqu01008]
 Polyketide tailoring proteins
  Others
   EJC51_31075
SSDB
Other DBs
NCBI-ProteinID: AZP23513
UniProt: A0A3S9IGV5
LinkDB
Position
6715314..6716267
AA seq 317 aa
MPALADNTIGGGAQAPNTNADANGDNLSVTAGGVVFDRSKNGSGTSTGALTSSTNWSPPP
CWYAPKYTPEQLQKTLEPIWEAESTGYEWDAEQRKKYNADDKEKGFNKDKTGKGYWWDSY
VDKSYPPGWDACDKGPFWVDTGDAPPAEYENAVTPEILAELAYNEIRVPGTKVTLAPAET
TKVNLPTWAWLDGAAFKPVSVTASVPVLHIQATATAEPVSLKIEPGTADAVTYPASGVCE
INNGRIGEPYAKGKADQTPPCGVKYLRSSGDATFPLRATVTWKITWTGTGGAGGDLPDGN
FGATQDVVVQEIQAVNR
NT seq 954 nt   +upstreamnt  +downstreamnt
gtgcccgccctcgccgacaacacgatcggcggcggcgctcaggcacccaacacaaatgct
gacgccaatggcgacaacctctctgtaaccgccggaggcgtcgtcttcgaccgttccaag
aacggcagcggtacctccaccggcgccctgacttcgagcaccaactggtccccgccccct
tgctggtacgcccccaagtacaccccggaacagctccagaagaccctcgagccgatctgg
gaagccgagtcgaccggctacgagtgggacgccgagcagcggaagaagtacaacgcggac
gacaaggagaagggcttcaacaaggacaagaccggcaagggctattggtgggactcgtac
gtcgacaagagctacccgcctggttgggacgcctgcgacaaggggcctttctgggtggac
acgggcgacgccccgcccgccgagtacgagaacgccgtcacccctgagatccttgccgaa
ctcgcctacaacgagattcgcgtacccggcaccaaggtcaccctggcacccgcagagacg
accaaggtcaacctccccacctgggcctggctcgacggcgccgccttcaagccggtctcc
gtcacggcctctgtcccggtgctccacatccaggcgaccgcgaccgcggagccggtctca
ctgaagattgagcccggtaccgccgacgccgtcacctacccggcctccggcgtatgcgag
ataaacaacggccgcatcggtgagccgtatgcgaagggcaaggcggaccagacgccaccc
tgcggagtgaagtacctgcgctcctcgggcgacgcgaccttccccctccgggccacggtc
acctggaagatcacctggaccggcaccggcggtgcgggtggtgacctgcccgacggcaac
ttcggcgcgacgcaggatgtcgtcgtacaggagatccaggccgtcaaccgctga

DBGET integrated database retrieval system