Sorex araneus (European shrew): 101550605 Help Entry 101550605         CDS       T07854                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism sara  Sorex araneus (European shrew) Pathway sara04080   Neuroactive ligand-receptor interaction sara04081   Hormone signaling sara04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101550605 (GHRH)    04081 Hormone signaling     101550605 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101550605 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101550605 (GHRH) Cytokines and neuropeptides [BR:sara04052]  Neuropeptides   GPCR binding    101550605 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  101550605 NCBI-ProteinID:  XP_004612698 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MRLWVFFLVTLTLGGESCCSPPSLPLRTPRYADAIFTSSYRKVLGQLSARKLLQDIMSRQ QGGRSQEQGAKARPGRAVDHGWATQEQVAPDSILGALLRERR NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcggctctgggtcttcttcctggtcaccctcaccctgggcggcgagtcctgctgctcc ccaccctccctgcccctcaggacaccgcgctacgcagacgccatcttcaccagcagctac cgcaaggtgctgggccagctgtcggcccgcaagctcctgcaggacatcatgagccggcag cagggagggcggagccaggagcagggagccaaggcccggcccggccgtgcggtggaccac gggtgggcgacccaagagcaggtggcaccggacagcatcctgggggccctgctgcgggag cgcaggtag

DBGET integrated database retrieval system