Sorex araneus (European shrew): 101554854 Help Entry 101554854         CDS       T07854                                  Symbol MAX Name (RefSeq) protein max   KO K04453   Max protein Organism sara  Sorex araneus (European shrew) Pathway sara03083   Polycomb repressive complex sara04010   MAPK signaling pathway sara05200   Pathways in cancer sara05202   Transcriptional misregulation in cancer sara05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:sara00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     101554854 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101554854 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101554854 (MAX)    05202 Transcriptional misregulation in cancer     101554854 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     101554854 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sara03000]     101554854 (MAX)    03036 Chromosome and associated proteins [BR:sara03036]     101554854 (MAX) Transcription factors [BR:sara03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     101554854 (MAX) Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      101554854 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA TPR bZIP_2 bHLH_INO4 Filament bHLH_SAC51 DUF4763 SlyX JAKMIP_CC3 GAGA_bind DUF7801 ANG-1 SLX9 bHLH_INO2 FapA ATG16 Motif Other DBs NCBI-GeneID:  101554854 NCBI-ProteinID:  XP_004612407 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE YIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGS TISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgctgacaaacgggctcatcataat gcactggaacgaaaacgtagggaccacatcaaagacagctttcacagtttgcgggactcg gtcccatcactccaaggagaaaaggcatcccgggcccaaatcctagacaaagccacagaa tatatccagtatatgcgaaggaaaaaccacacacaccagcaagatattgacgacctcaag cggcagaatgctcttctggagcagcaagtccgtgcactggagaaggcgaggtcgagtgcc cagctgcagaccaactacccctcctcagacaacagcctctacaccaacgccaagggcagc accatctctgccttcgacgggggctcagactccagctcagagtcggagcccgaagagcct caaagcaggaagaagctccggatggaggccagctaa

DBGET integrated database retrieval system