KEGG   Salmo salar (Atlantic salmon): 106613352
Entry
106613352         CDS       T04363                                 
Symbol
mrap
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB
Motif
Pfam: MRAP DUF4083 LapA_dom
Other DBs
NCBI-GeneID: 106613352
NCBI-ProteinID: XP_014070944
UniProt: A0A1S3T2X6
LinkDB
Position
ssa09:complement(137357821..137359287)
AA seq 91 aa
MRMINSTNSSQDSWRYEWEYYYDYLDPIPVDERKLKYNKYLIVIIFWISLAAFVGFLFVI
LTFMSRSVSLPKAHSSKKAKKSWRNPRSNSA
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaggatgataaactccactaactcctcacaggattcatggagatacgagtgggaatat
tactacgattatttagacccaataccagtggacgagcgcaaactgaaatataacaagtac
ttgatcgtgatcatattctggatcagtctggctgcttttgtgggattcctgtttgtcatt
ttgactttcatgtcccgctcagtcagtctacccaaagctcacagttctaaaaaggccaag
aaatcgtggaggaaccctagatccaattctgcttga

DBGET integrated database retrieval system