KEGG   Streptomyces calvus: CD934_11630
Entry
CD934_11630       CDS       T06819                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sast  Streptomyces calvus
Pathway
sast01057  Biosynthesis of type II polyketide products
sast01100  Metabolic pathways
sast01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sast00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CD934_11630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sast01008]
    CD934_11630
Polyketide biosynthesis proteins [BR:sast01008]
 Polyketide tailoring proteins
  Others
   CD934_11630
SSDB
Other DBs
NCBI-ProteinID: QDI69279
UniProt: A0A514JPL0
LinkDB
Position
complement(2833437..2834465)
AA seq 342 aa
MSALRKSARTVTVLTLACASLFLSHTAFAGRGSNGNANEADQSAHADGEGNLSVTVGGIV
FDRSKNGSGGSAGALTSSTSWTPPACWYAPKYTPEQLQKYLEPIWEAGSTGYEWDAEQRK
KYNADDEKKAFNKDKSGEGYWWGSYVNESYPPGWDACDKDYFWVDKGDPPPAGIENAVTP
EILAELAYAEIRVPGTEVTLAPAEATKVNLPTWAWLDGAEFKPVSVTASVPTIGIQATAT
AEPVSLQIKPGTPDAETYPASGVCEINDGRIGEPYAKGKADETPPCGVKYLRSSGDGSFP
LRATVTWEIHWTGTDGAGGDLPDGDFGATQDVVVQEIQAINR
NT seq 1029 nt   +upstreamnt  +downstreamnt
gtgtcagccctgaggaaatcggccaggaccgtcacggtcctcacactcgcgtgcgcttcc
ctcttcctttcgcatacggcatttgccggacgcggctcgaacgggaacgccaacgaggcc
gaccagagtgctcacgccgacggcgagggcaacctctccgtgaccgtgggcggcatcgtc
tttgaccgttcgaagaacggcagcggcggttccgcgggcgcgctgacgtcgtccacgtca
tggacgcccccggcctgctggtacgcccccaagtacacgcccgagcagttgcagaagtac
ctggagccgatctgggaagccggctccacggggtacgagtgggacgccgagcagcggaag
aagtacaacgccgacgacgagaagaaggccttcaacaaggacaagtccggcgaaggctat
tggtggggctcgtacgtcaacgagagctacccgcccggctgggacgcctgcgacaaggac
tacttctgggtggacaagggcgaccccccgcccgccggcatcgagaacgccgtcaccccg
gagatcctcgccgaactcgcctacgccgagatccgcgtcccgggcaccgaggtgacgctg
gccccggcggaggcgaccaaggtgaacctgccgacctgggcctggctggacggcgcggag
ttcaagccggtctcggtcaccgcgtcggtgccgacgatcggcatccaggcgaccgccacg
gcggagccggtctcgctgcagatcaagccgggcacgccggacgccgagacgtacccggcc
tcgggtgtctgcgagatcaacgacggccgtatcggcgagccctacgcgaagggcaaggcg
gacgagacgccgccgtgcggggtgaagtacctgcgctcctcgggcgacggctcgttcccg
ctccgggccacggtcacctgggagatccactggacgggcaccgacggcgcgggcggtgac
cttcccgacggcgacttcggagcgacacaggacgtcgtcgtacaggagatccaggccatc
aaccgctga

DBGET integrated database retrieval system