KEGG   Streptomyces bathyalis: G4Z16_02340
Entry
G4Z16_02340       CDS       T07305                                 
Name
(GenBank) cytochrome P450
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
sbat  Streptomyces bathyalis
Pathway
sbat00997  Biosynthesis of various other secondary metabolites
sbat01100  Metabolic pathways
sbat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbat00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    G4Z16_02340
Enzymes [BR:sbat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     G4Z16_02340
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QPP10347
UniProt: A0A7T1WVL5
LinkDB
Position
518020..519366
AA seq 448 aa
MSPPADRTWRTGKAPGALPLLGHVLPLWRDPLGFLASLPSHGDVVEVRIGPGRAYLVNHP
ELVRHVLLHPRVFDKGGIFDKARQLLGNSLSVSRGEEHRYQRRLVQPAFRPGKIAEYTRA
VADDTNSAIAAWSSGDVRNISDEMHALLMRVAARTLFSTGLDDATIEEARHCLRTVSLGI
YKRAMAPLGVMEKLPTPAKRAYDHANTRLREIVATMIDTQRRSPSDRQDLVSTLLRAEHP
VTGEKLTDRELLDQVVTFLIAGSETTASTLAFVFHLMGAFPEVEKRVHTEIDEAVGDRAP
AYEDLPSLPYTRNVITEALRLYPPSWMAMRVAVEDVELGGLPVRSGAMVLYSAYAMHRNP
ELFPSPETFDPGRWEADRAARVPRGALLPFGAGSHKCIGDVLALTETTLIVAAIAAGWRL
RPVPGTRLRPEPRATLEAGPLPMICERR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atctctcccccggcggaccgcacttggcggaccggcaaggcccccggcgccctcccgctg
ctggggcacgtccttccgctctggcgcgacccgctgggcttcctggcctcactgccctcc
cacggcgacgtggtcgaggtccgcatcggccccggccgcgcctacctcgtcaaccatccc
gagctggtcagacacgtactgctccacccgcgggtcttcgacaagggcgggatcttcgac
aaggcgcggcaactgctcggcaacagcctgtccgtgtcccgcggtgaggagcaccggtac
cagcgccggctcgtccagcccgccttccgcccggggaagatcgccgagtacacgcgcgcc
gtcgccgacgacacgaactcggcgatcgccgcatggagttcgggcgacgtacggaacatc
agcgacgagatgcacgcactgctgatgcgcgtggccgcgcggaccctcttctccacgggt
cttgacgacgccacgatcgaagaggcccggcactgcctgcgaaccgtttccctggggatc
tacaaacgggccatggcaccgctgggagtcatggagaagctgcccactccggcgaagcgc
gcctacgaccacgccaacaccaggctgcgggaaatcgtggcgacgatgatcgacacccag
cggcggtccccctccgaccggcaggatctggtgtcgacgctgctgcgtgccgagcatccg
gtgaccggggagaagctcacggaccgcgaactgctggaccaggtcgtcacgttcctgatc
gccggcagtgagaccacggcctcgacgctcgccttcgtattccacctgatgggggccttc
cccgaggtcgagaagcgggtccacacggagatcgacgaggccgtcggggaccgggctccg
gcctacgaggacctgccgtcactcccctacacgcgcaacgtcatcaccgaggcgctgcgc
ctctacccgccgtcctggatggcgatgagggtggcggtcgaggacgtcgaactcggcggc
ctgccggtccggtcgggcgccatggtcctctacagcgcctacgccatgcaccgcaatccg
gagctgttcccctccccggagacgttcgaccccgggcgctgggaagcggaccgggccgcg
cgggtgccccgcggcgcgctgctgccgttcggcgccggcagccacaagtgcatcggcgac
gtgctggcgctcaccgagacgacgctcatcgtcgcggccatcgcggcgggttggcggctg
cgcccggtgcccggaacccggctgcgcccggaaccgagggcgacgctcgaggccggaccg
ctgcccatgatctgcgaacggcgttga

DBGET integrated database retrieval system