KEGG   Streptomyces bingchenggensis: SBI_00621
Entry
SBI_00621         CDS       T01678                                 

Name
(GenBank) scyllo-inosamine-4-phosphate amidinotransferase
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00521  Streptomycin biosynthesis
sbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_00621
Enzymes [BR:sbh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     SBI_00621
SSDB
Motif
Pfam: ADI
Other DBs
NCBI-ProteinID: ADI03742
UniProt: D7C288
LinkDB
Position
complement(795257..796297)
AA seq 346 aa
MSLVDVHNEWDPLEEVIIGTVTGARVPVPDKGLFTLEYADYGTVDKVPSGPYAQHIVEET
EEELSRLCAELTKIGVKVRRPEARDHAAQLATPDWQTDGFYDYCPRDVFLTVGSTVIETP
MVLRSRFLEPFAYKNMLLEFFESGARWISAPKPRLGDDMYDMDAEPGRRLGNLEPAFDAA
NMMRCGTDLLYLVSDSGNELGWKWLQSALGDTYKVHPCRDIYTGTHIDTTIVPLRPGLVL
LNPERVNDKNMPDYLRDWDHLWCPEMTETEYEGKHPYGSPWVGMNLLVINEDLVVADERQ
PALLRALEKRGIDVLPMRLTHARTLGGSFHCVSLDIRRTGTLETYR
NT seq 1041 nt   +upstreamnt  +downstreamnt
gtgagtctggtcgatgtgcacaacgagtgggacccgctcgaagaagtcatcatcggcacc
gtgaccggcgcccgcgtaccagtccccgacaagggcctgttcactctggagtacgcggac
tacggcacggtcgacaaagtcccttccggtccgtatgcgcagcatattgtcgaggagacc
gaagaggagttgtcgaggctctgcgcggagctcacgaaaatcggcgtgaaggtccggcgg
cccgaggcccgtgatcacgcggcgcagctcgccaccccggactggcagaccgacggcttc
tacgactactgcccgcgcgatgtctttctgaccgtgggcagcaccgtcatcgagaccccc
atggttcttcggtcgagattcctggaacccttcgcctacaagaacatgctgctggagttc
tttgaaagcggagcgcgatggatatcggcgccgaagccacggctcggcgacgacatgtac
gacatggacgccgagcccgggcgtcggctcggaaacctggaacccgcattcgacgccgcc
aacatgatgcgctgcgggacggatctgctgtatctggtgtcggacagcggaaacgaactg
ggctggaaatggctccagtcggcgctgggagacacgtacaaggttcacccgtgccgtgac
atctacacgggaacccatatcgacaccaccattgtcccgctccggcccggactcgtactc
ctcaatcccgagcgcgtcaacgacaagaacatgccggactacctccgcgactgggaccat
ctctggtgcccggaaatgaccgagaccgaatatgagggcaagcacccctacggttccccc
tgggtcggcatgaacctcctggtcatcaatgaggatctggtagtggcggacgagcggcag
cccgcgcttctccgcgctctcgagaagcgcgggatcgacgtccttccgatgcgcctcacc
cacgcgcgcaccctgggaggatcgttccactgcgtctccctcgacatacgcagaacggga
acactggagacgtaccgctga

DBGET integrated database retrieval system