KEGG   Streptomyces bingchenggensis: SBI_09677
Entry
SBI_09677         CDS       T01678                                 

Name
(GenBank) dioxygenase
  KO
K18057  pentalenolactone F synthase [EC:1.14.11.36]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00999  Biosynthesis of various secondary metabolites - part 1
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Module
sbh_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    SBI_09677
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.36  pentalenolactone F synthase
     SBI_09677
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: ADI12795
UniProt: D7CBB8
LinkDB
Position
11552456..11553355
AA seq 299 aa
MDVTPIPGAALGAVVHGAHVTDDMDKTQLEEIWAALDAHLVLVFRGHETPSFEEFLAFGR
RFGYIPKTGLTSGAHPDHNEILIVSNLVEDGRKIGVGDAEWMGWHTDYSFRPRVSQVGFL
EAVEVPSSGGGETLFTDMYALYESLSPEERRRLHSYRARHALRTGYEETIEEELQGEVSL
GESTEQIQPEDGTSTIHPLIARNPRTGRQSVYISTLNTKRIVDLAPDDSRKLLDELLSHA
GKPQHTYAHTWQPGDIVVWDQLGTVHAKQAFDPAERRIMRQVVSIFDDPTDPWRAEVAA
NT seq 900 nt   +upstreamnt  +downstreamnt
atggacgtaacgccgatacccggcgccgctctcggtgccgtcgtgcacggcgcccatgtc
accgacgacatggacaagacccagttggaggagatctgggcggcgctcgacgcgcatctc
gtactcgtcttccgcggccacgagaccccctccttcgaggagttcctggccttcggccgc
cgcttcgggtacatcccgaagaccggtctgaccagcggcgcccaccccgaccacaacgag
atcctgatcgtctccaacctggtggaggacggccgcaagatcggcgtcggcgacgccgag
tggatgggctggcacaccgactactccttccgaccccgcgtctcccaggtcggcttcctg
gaggccgtggaagtgccgtcctccggcggcggggagaccctcttcaccgacatgtacgcc
ctgtacgagtcgctgtcgcccgaagagcgccgacgcctgcactcctaccgggcccgccac
gccctgcgcaccgggtacgaggagaccatcgaggaggagctccagggcgaggtgtccctc
ggcgagagcaccgaacagatccagcccgaggacggcacctccaccatccacccgctgatc
gcccgcaatccgcgcaccggccgccagtcggtctacatcagcaccctgaacaccaagcgg
atcgtggacctcgcccccgacgacagccgcaagctgctcgacgaactgctgtcgcacgca
ggcaagccccagcacacctacgcccacacctggcaacccggggacatcgtcgtatgggac
cagctcggcaccgtccacgccaagcaggccttcgacccggccgaacggcgcatcatgcgc
caggtcgtcagcatcttcgacgacccgaccgacccctggcgcgcggaggtcgccgcatga

DBGET integrated database retrieval system