KEGG   Sorghum bicolor (sorghum): 110433086
Entry
110433086         CDS       T01086                                 

Name
(RefSeq) nicotianamine aminotransferase A-like
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00997  Biosynthesis of various secondary metabolites - part 3
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    110433086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    110433086
Enzymes [BR:sbi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     110433086
Amino acid related enzymes [BR:sbi01007]
 Aminotransferase (transaminase)
  Others
   110433086
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Glyco_hydro_20
Other DBs
NCBI-GeneID: 110433086
NCBI-ProteinID: XP_021310384
LinkDB
Position
2
AA seq 440 aa
MATDGGEKGSSGHAAAEWRFARAAAAKEEGALAVAGDKMSIRAARFKISASVDARDPRPV
LPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLPDARRALAEHLSSDLPYK
LSTDDIFLTAGGTQAIEVVVSVLAQPGTNILLPRPGYPNYEARAGLHNLEVRRFDLIPER
GWEIDIDSLESIADKNTTAMVIINPNNPCGSVYTHEHLAKVAEVARKLGILVIADEVYGN
LVFGDTPFVPMGVFGHIAPVLSIGSLSKRWIVPGWRLGWVAVCDPNKILLNTKIIASITN
FLNISTDPATFIQGALPHILENTKEDFFKRIIGLLAETSEICYREIKDIKCITCPHKPEG
SMFVMVKLNLYLLEGIHDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAIDSSSLLDG
LERIKSFCQRHKKKNLLNGH
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgaccgacggcggcgagaagggcagcagcggccacgcggcggcggagtggcggttc
gcgcgggcggcggcggccaaggaggagggcgcgctggccgtggccggggacaagatgagc
atccgggcggcgcggttcaagatcagcgcgagcgtggacgcgcgcgacccgcggcccgtg
ctgccgctggcgcacggggacccctcggtgttcccggccttccgcaccgccgccgaggcc
gaggacgccgtggccgccgcgctccggaccggcaagttcaactgctaccccgccggcgtc
ggcctccccgacgcccgccgtgctctggcggagcacctgtcaagtgatcttccatacaag
ctgtcaactgatgacatcttcctcactgctggaggcactcaagcaattgaggttgtcgtc
tcagtgcttgctcaaccgggcaccaacatattgctcccaagaccaggctatccaaattat
gaggcgcgtgcagggctgcacaacttagaagttcgtcgtttcgatctgattcctgaaaga
ggctgggaaattgatatcgactctctcgagtcgattgctgacaagaacaccactgcaatg
gtcatcataaaccccaacaatccttgcgggagtgtctatacccatgaacatttagccaag
gtcgcggaggtagcaaggaagcttggaatcctagtcatcgctgatgaagtatatggaaat
ctggtgtttggggacacccctttcgtccccatgggtgtctttggccacattgcccctgtg
ttgagcataggatcactatcaaagagatggatagtgcctgggtggcgacttggttgggta
gctgtatgtgatcccaacaagattctgctaaacacaaagatcattgcatcgatcacaaac
ttccttaacatttcaactgatccagcaacttttattcagggagcacttccccatattctt
gagaacacaaaggaagattttttcaagaggatcattggtctgctagcggaaacatcagag
atatgttacagagaaataaaggacatcaagtgcatcacttgccctcacaagccagaaggt
tccatgtttgtcatggtgaaattaaatttgtatcttctggaagggatccatgatgatatt
gatttttgctgcaagctggcaaaagaagagtccgtgattttgtgtccagggagtgttttg
ggaatggaaaactggatccgtatcactttcgccattgattcatcttctcttcttgatggt
cttgagaggatcaaatctttctgccaaaggcataagaagaagaatttgcttaatggtcat
taa

DBGET integrated database retrieval system