KEGG   Sorghum bicolor (sorghum): 110435085
Entry
110435085         CDS       T01086                                 

Name
(RefSeq) P-(S)-hydroxymandelonitrile lyase
  KO
K08249  hydroxymandelonitrile lyase [EC:4.1.2.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00460  Cyanoamino acid metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110435085
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.11  hydroxymandelonitrile lyase
     110435085
SSDB
Motif
Pfam: Peptidase_S10
Other DBs
NCBI-GeneID: 110435085
NCBI-ProteinID: XP_021316122
LinkDB
Position
4:66773690..66778436
AA seq 510 aa
MAVFISSSGSPGRATATTTTTTTLLLAVLAAAAAAGLLLAPVAARGSPPEHDKQLQLQQQ
EDDRILGLPGQPNGVAFGMYGGYVTIDDNNGRALYYWFQEADTADPAAAPLVLWLNGGPG
CSSIGLGAMQELGAFRVHTNGESLLLNEYAWNKAANILFAESPAGVGFSYSNTSSDLSMG
DDKMAQDTYTFLVKWFERFPHYKYREFYIAGESGHFIPQLSQVVYRNRNNSPFINFQGLL
VSSGLTNDHEDMIGMFESWWHHGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQ
GNINPYTIYTPTCDREPSPYQRRFWAPHGRAAPPPLMLPPYDPCAVFNSINYLNLPEVQT
ALHANVSGIVEYPWTVCSNTIFDQWGQAADDLLPVYRELIQAGLRVWVYSGDTDSVVPVS
STRRSLAALELPVKTSWYPWYMAPTEREVGGWSVQYEGLTYVTVRGAGHLVPVHRPAQAF
LLFKQFLKGEPMPAEEKNDILLPSEKAPFY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggccgtcttcatcagctcctccggctcgccagggcgcgccacggcgacgaccacgacg
acgacgacgctcctactcgcagtactagcggccgccgctgccgccggcctcctcttggcg
ccggtcgcggcacgcgggtcaccgcccgagcacgacaagcagctgcagctgcagcagcag
gaggacgaccgcatcctggggctgccggggcagcccaacggcgtggcgttcggcatgtac
ggcggctacgtgaccatcgacgacaacaacggccgcgcgttgtactactggttccaagag
gccgacaccgccgacccggcggccgcgccgctcgtcctctggctcaacggcgggcctggg
tgctcctccatcggcctaggcgccatgcaggagctcggcgcgttccgcgtccacaccaac
ggcgagagcctcttgctcaacgagtacgcatggaacaaagccgccaacatactcttcgca
gagtcgccggccggtgtgggattctcttacagcaacaccagctctgacctatccatgggc
gatgacaaaatggcccaggacacgtacactttcctggtgaaatggttcgagaggttcccg
cactacaagtaccgcgaattctatattgccggggaaagcggccactttattccacagctc
tcccaagttgtgtacaggaacaggaacaactcacctttcattaacttccaagggttgctg
gtttccagtggtctgaccaacgaccacgaagacatgatcggcatgttcgagtcgtggtgg
caccacggcctcatctccgacgagacccgggacagcgggctcaaggtctgcccgggcacc
tccttcatgcaccccacgccggagtgcaccgaggtgtggaacaaggccctggccgagcaa
ggcaacatcaacccctacaccatctacacgcccacgtgcgacagggagcccagcccgtac
cagcgcaggttctgggcgccccacggccgcgccgccccaccaccattgatgctgcccccc
tacgacccctgcgcagtcttcaactccatcaactacttgaatctccccgaggtgcaaacg
gccttacatgccaatgtcagcggcatcgtagagtacccatggactgtatgcagcaatacc
atatttgatcagtggggacaggcagccgatgacctgctacccgtctatagggagctcatt
caagctggactcagggtctgggtctacagtggtgacacagacagtgtagtgccggtgagt
tcgaccaggcgctctcttgccgccctggagcttcctgttaaaactagctggtacccatgg
tacatggccccaaccgagcgcgaggttggtggctggagcgtgcagtatgaaggcctgacc
tatgtcaccgtccgtggcgccgggcacttggttcctgtgcaccgtccggcacaggcgttc
ctcctgttcaagcaattcctcaagggcgaacccatgccggccgaggaaaagaatgacatc
ctccttcctagtgagaaggctcccttctactga

DBGET integrated database retrieval system