Shigella boydii Sb227 (serotype 4): SBO_2251 Help Entry SBO_2251          CDS       T00301                                  Symbol yccB Name (GenBank) Uncharacterized protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism sbo  Shigella boydii Sb227 (serotype 4) Pathway sbo00190   Oxidative phosphorylation sbo01100   Metabolic pathways sbo02020   Two-component system Module sbo_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sbo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SBO_2251 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SBO_2251 (yccB) Enzymes [BR:sbo01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SBO_2251 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  ABB66816 ShiBASE_China:  SBO2251 UniProt:  Q31YP2 LinkDB All DBs Position complement(2239778..2239870) Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system