KEGG   Shigella boydii Sb227 (serotype 4): SBO_P066
Entry
SBO_P066          CDS       T00301                                 

Symbol
ipaH4.5
Name
(GenBank) invasion plasmid antigen
  KO
K23830  E3 ubiquitin-protein ligase IpaH4.5 [EC:2.3.2.27]
Organism
sbo  Shigella boydii Sb227 (serotype 4)
Pathway
sbo05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sbo00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SBO_P066 (ipaH4.5)
Enzymes [BR:sbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     SBO_P066 (ipaH4.5)
SSDB
Motif
Pfam: NEL TTSSLRR LRR_4 LRR_8
Other DBs
NCBI-ProteinID: ABB68938
ShiBASE_China: SBOP066
UniProt: Q31SM0
LinkDB
Position
pSB4_227:complement(48874..50598)
AA seq 574 aa
MKPINNHSFFRSLCGLSCISRLSVEEQCTRDYHRIWDDWAREGTTTENRIQAVRLLKICL
DTREPVLNLSLLKLRSLPPLPLHIRELNISNNELISLPENSPLLTELHVNGNNLNILPTL
PSQLIKLNISFNRNLSCLPSLPPYLQSLSARFNSLETLPELPSTLTILRIEGNRLTVLPE
LPHRLQELFVSGNRLQELPEFPQRLKYLKVGENQLRRLSRLPQELLTLDVSNNLLTSLPE
NIITLPICTNVNISGNPLSTRVLQSLQRLTSSPDYHGPQIYFSMSDGQQNTLHRPLADAV
TAWFPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLST
SAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFR
LEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTA
EAMVRSREENEFKDWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENEYSQRVADRLKAS
GLSGDTDAEREAGAQVMRETEQQIYRQLTDEVLA
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgaaaccgatcaacaatcattctttttttcgttccctttgtggcttatcatgtatatct
cgtttatcggtagaagaacagtgtaccagagattaccaccgcatctgggatgactgggct
agggaaggaacaacaacagaaaatcgcatccaggcggttcgattattgaaaatatgtctg
gatacccgggagcctgttctcaatttaagcttactgaaactacgttctttaccaccactc
cctttgcatatacgtgaacttaatatttccaacaatgagttaatctccctacctgaaaat
tctccgcttttgacagaacttcatgtaaatggtaacaacttgaatatactcccgacactt
ccatctcaactgattaagcttaatatttcattcaatcgaaatttgtcatgtctgccatca
ttaccaccatatttacaatcactctcggcacgttttaatagtctggagacgttaccagag
cttccatcaacgctaacaatattacgtattgaaggtaatcgccttactgtcttgcctgaa
ttgcctcatagactacaagaactctttgtttccggcaacagactacaggaactaccagaa
tttcctcagcgcttaaaatatttgaaggtaggtgaaaatcaactacgcagattatccaga
ttaccgcaagaactattgacactggatgtttccaataacctactaacttcattacccgaa
aatataatcacattgcccatttgtacgaatgttaacatttcagggaatccattgtcgact
cgcgttctgcaatccctgcaaagattaacctcttcgccggactaccacggcccgcagatt
tacttctccatgagtgacggacaacagaatacactccatcgccccctggctgatgccgtg
acagcatggttcccggaaaacaaacaatctgatgtatcacagatatggcatgcttttgaa
catgaagagcatgccaacaccttttccgcgttccttgaccgcctttccgataccgtctct
gcacgcaatacctccggattccgtgaacaggtcgctgcatggctggaaaaactcagtacc
tctgcggagcttcgacagcagtctttcgctgttgctgctgatgccactgagagctgtgag
gaccgtgtcgcgctcacatggaacaatctccggaaaaccctcctggtccatcaggcatca
gaaggccttttcgataatgataccggcgctctgctctccctgggcagggaaatgttccgc
ctcgaaattctggaggacattgcccgggataaagtcagaactctccattttgtggatgag
atagaagtctacctggccttccagaccatgctcgcagagaaacttcagctctccactgcc
gtgaaggaaatgcgtttctatggcgtgtcgggagtgacagcaaatgacctccgcactgcc
gaagccatggtcagaagccgtgaagagaatgaatttaaggactggttctccctctgggga
ccatggcatgctgtactgaagcgtacggaagctgaccgctgggcgcaggcagaagagcag
aagtatgagatgctggagaatgagtactctcagagggtggctgaccggctgaaagcatca
ggtctgagcggtgatacggatgcggagagggaagccggtgcacaggtgatgcgtgagact
gaacagcagatttaccgtcagttgactgacgaggtactggcctga

DBGET integrated database retrieval system