KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101028223
Entry
101028223         CDS       T04350                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00250  Alanine, aspartate and glutamate metabolism
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101028223 (RIMKLA)
Enzymes [BR:sbq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     101028223 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     101028223 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 101028223
NCBI-ProteinID: XP_003937032
UniProt: A0A2K6TUR6
LinkDB
Position
Unknown
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPTRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTLGAPPSLLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgaccgaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccgtcgtcggcggccacctcggcctccagctaaaccag
aaggccctcaccaccttcccagatgtcgtacttgtgcgggtacccacaccctcagtacag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgtccacagagcatcttaaattgcatcaacaaattctggacgttccaagaactggctgga
catggagtccccatgccagacaccttctcctatggtgggcatgaagacttctcaaaaatg
attgatgaagctgagcccctgggctacccggtcgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccatgatgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaagtcataggctctatgcttcgctgttccactgatgga
cggatgcagagcaactgctctctcggtggcgtaggcgtcatgtgcccgctgacagaacaa
ggcaagcagttggccattcaggtgtccaacatcctaggcatggacttctgtggcattgat
ctgcttatcatggacgatggctcctttgtggtgtgtgaggcaaacgctaatgtcggcttc
ctcgcctttgaccaggcgtgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaactaggcagactgggaagatggctgtcctcccaggactgtcgagtccg
agggagaagaacgagccagacggctgtgcttcagctcagggagttgcagagagtgtctat
accatcaacagtgggtctacctctagcgaaagtgagcctgaactgggagagatccgggat
tcctcagcaagcacactgggggcgccaccctccttgctgcccgaacctggctacaacatt
aacaacaggattgcttctgaattaaaacttaagtga

DBGET integrated database retrieval system