KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038763
Entry
101038763         CDS       T04350                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04610  Complement and coagulation cascades
sbq04810  Regulation of actin cytoskeleton
sbq05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101038763 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101038763 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101038763 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:sbq04515]
    101038763 (ITGAX)
   04090 CD molecules [BR:sbq04090]
    101038763 (ITGAX)
Cell adhesion molecules [BR:sbq04515]
 Integrins
  Integrin alpha subunits
   101038763 (ITGAX)
CD molecules [BR:sbq04090]
 Proteins
  101038763 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VWA_CoxE Integrin_alpha VWA_3
Other DBs
NCBI-GeneID: 101038763
NCBI-ProteinID: XP_010339154
LinkDB
Position
Unknown
AA seq 1147 aa
MSDLPVMTRTRAALLLFTALATSLGFNLDTEQLTAFRVDSAGFGDSVVQYANSWVVVGAP
HKVTAANQTGGLYQCSYGSGACQPIRLQIPAEAVNMSLGLSLAATTSPSQLLACGPTVHH
ACGRNMYLTGLCFLLAPALLTQRLPAFMQECPRQEQDIVFLIDGSGSISDNNFATMKSFV
RAVMSHFQRPSTQFSLVQFSSEFRTHFTFKEFRDSSNPLSLLASVKQLRGYTHTATAIQK
VVRELFLASNGARRDATKILIVITDGKKEGDRLDYDDVIPMADKAGIIRYAIGVGSAFQY
RNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQE
GFSAVFTPDGPVLGAVGSFSWSGGAFLYPPNVNPTFINMSQENVDMRDSYLGYSTQLALW
KGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQVGSYFGASLCSVDMDSDGSTD
LILIGAPHYYEQARGGQVSVCPLPRGWSKWWCNAVLRGEQGHPWGRFGAALTVLGDVSGD
KLTDVAIGAPGEEEDRGAVYLFHGDSGPSISTSYSQRITGSQLSPRLRYFGQALSGGQDL
TQDGLVDLAVGARGQVLLLRSAFECREQEVSDQPLGQASICLYIDNISRNLLGSRDLQSS
VTLDLALDPGRLSPRATFQETKSRSLSRVQVLGLKTHCEKFDLLLPACVEDSVTPITLRL
NFTLVGEPLPYFRNLQPMLAADAQRYFTASLPFEKNCGADHICQDDLGISFSFPGLKTLL
VGSNPELNTEVMVWNDGEDSYGTAITFSHPAGLSYRHVAEGQKQGQLRSLRLTCDSAPAG
SQGTWSTSCRINHLIFREGAQITFLATFDISPKAVLGDRLLLVANVSSENNTPRTSKTTF
QLELPVKYTVYTVASSHEQSTKYFNFSASEEKESRVATHRFQVNNLGQRDLPVSISFWVP
VELNQEAVWTEVEVSHPQDPSLRCSSEKTAPPVSDFLAYIQKNPVLDCSIAGCLRFRCDV
PSFSVQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEMTFDTSVYSQLPGQEAFMRAQTM
TVLEMYEIHNPTPLIVGSSVGGLLLLALITAALYKVGFFKRQYKEMMEKANGQIAPENRT
SDPQPAQ
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgaccaggaccagggcagcgctcctcctgttcacagcctta
gcaacttctctgggtttcaacttggacacagagcagctgacagccttccgtgtggacagc
gctgggtttggagacagcgtggtccagtatgccaactcctgggtggtggttggagccccc
cacaaggtgacggctgccaatcaaacaggcggcctgtaccagtgcagctacggcagcggc
gcctgtcagcccatccgcctgcagatccccgcagaggcggtgaacatgtccctgggtctg
tccctggcggctaccaccagcccctcccagctgctggcctgcggccccactgtgcaccac
gcatgtgggaggaacatgtacctgactggactctgcttcctcctggcccctgccctgctc
acccagaggctcccggcgttcatgcaggagtgcccgagacaggagcaggacattgtgttc
ctgattgatggctcgggcagcatctcagacaacaactttgccacgatgaagagcttcgtg
agagctgtgatgagccacttccagagacccagcacccagttttccctggtgcagttctcc
agcgaattccgaacacacttcactttcaaggaattcagggacagctcaaaccccctcagc
ctgttggcttctgttaagcagctgagagggtacacacacacggccaccgccatccaaaaa
gttgtgagggaattgttccttgcctcgaatggggcccgcagggatgccaccaagatcctc
attgtcattactgatgggaagaaagaaggagaccggctggattatgatgatgtcatcccc
atggcggacaaagcaggcatcatccgctatgcaattggggttggatcagcttttcaatac
agaaactcctggaaagaattaaatgacattgcatcgaagccctcccaggaacacatattt
aaagtggaggactttgatgctctgaaagatattcagaaccaactgaaggagaagatcttt
gccattgagggtactgagacgacaagcagcagctccttcgaattggagatggcgcaggaa
ggcttcagtgctgtgttcacgcctgatggccccgtcctgggggctgtggggagcttcagc
tggtctggaggtgccttcctgtaccccccaaatgtgaaccccaccttcatcaacatgtct
caggagaatgtggacatgagggattcttacctgggttactccacccagctggccctgtgg
aagggggtacagagcctggtcctgggggccccccgttaccagcacaccgggaaggctgtc
atcttcacccaggtgtccaggcaatggaggatgaaggctgaagtcacggggacccaggtc
ggctcctactttggggcctccctctgctccgtggacatggacagcgatggcagcaccgac
ctgatcctcatcggggccccccattactacgagcaggcccgagggggccaggtgtccgtg
tgccccttgcccagggggtggagcaagtggtggtgtaatgcggttctccgaggggagcag
ggccacccctggggccgctttggggcagctctgacagtgctgggggacgtgagtggggac
aagctgacggatgtggccatcggggccccaggagaggaggaagaccggggtgctgtctac
ttgtttcacggagactcgggacccagcatcagcacctcctacagtcagcggatcacgggc
tcccagctgtcccccaggctgcggtatttcgggcaggcgctgagcgggggtcaggacctc
acccaggatggactggtggacctggcggtgggggcccggggccaggtgctcctgctcagg
tctgcgtttgagtgtcgggagcaggaggtctctgaccagcccctgggacaggccagcatc
tgcctttacattgacaacatttccaggaacctgctcgggagccgtgacctccaaagctct
gtgaccttggacctggccctcgaccctggccgcctgagtccccgtgctaccttccaagaa
acaaagagccggagtctgagccgagtccaagtccttgggctgaagacacactgtgaaaaa
ttcgatctgctgctcccggcctgcgtggaggactctgtgactcccatcaccttgcgtctg
aacttcacgctggtgggcgagcccctcccttacttccgaaacctgcagcctatgctggcc
gccgatgctcagagatacttcacagcctccctcccctttgagaagaactgtggagccgac
catatctgccaggacgatcttggcatctccttcagcttcccaggcttgaagaccctgctg
gtggggagtaacccggagctaaacacagaagtgatggtgtggaacgacggggaagactcc
tacggaaccgccatcaccttctcccacccggcaggactgtcctaccgccacgtggcagag
ggccagaaacagggacagctgcgctccctgcgcctgacatgtgacagcgccccagctggg
agccagggcacctggagcaccagctgcagaatcaaccacctcatcttccgtgagggcgcc
cagatcaccttcttggctacctttgacatctcacccaaggctgtcctgggagaccggctg
cttctggtagccaatgtgagcagcgagaacaacacccccaggaccagcaagaccaccttc
cagctggagctccctgtgaagtacaccgtctacaccgtggccagcagccatgaacaatcc
accaagtacttcaacttctcagcctccgaggagaaggaaagccgtgtggccacacacaga
ttccaggtcaacaacctcggacagagggacctgcctgtcagcatcagcttctgggtgcct
gtggagctgaaccaggaggctgtgtggacggaggtggaggtctcccatccccaggaccca
tctcttcggtgctcctcggagaaaactgcacccccagtgtctgacttcctggcgtacatt
cagaagaatcctgtgctggactgctccattgctggctgcctgcggttccgctgtgacgtt
ccctccttcagcgtccaggaggagctggacttcaccctgaagggcaacctcagctttggc
tgggtccgccagacgtcgcagaagaaggtatccgtcgtgagtgtggctgaaatgacattc
gacacatccgtgtactcccagcttccgggacaggaggcatttatgagggctcagactatg
acggtgctggagatgtacgagatccacaaccccaccccactcatcgtgggcagctccgtg
gggggtctgctgctgctggcgctcatcacagccgcactgtacaaagttggctttttcaag
cgtcagtacaaggaaatgatggagaaggcaaatggacaaattgccccagaaaacaggaca
tcagacccccagcctgcccagtga

DBGET integrated database retrieval system