KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040454
Entry
101040454         CDS       T04350                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04927  Cortisol synthesis and secretion
sbq04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101040454 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101040454 (MRAP)
SSDB
Motif
Pfam: MRAP T4SS_pilin
Other DBs
NCBI-GeneID: 101040454
NCBI-ProteinID: XP_003927715
UniProt: A0A2K6U2D7
LinkDB
Position
Unknown
AA seq 174 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEMKLKAHKYSIVIALWVSLAAFVMLLFLILLYM
SWSGSPQMRNSPKHHQTCLWSHSLNLHLCIQKCLPCRYRREPLGTSQALVRSVEPGSRTG
SDQPLRQESSSTLRPGVFQTQSTLFWEMTLDGGPLVRSKPREPPPGDRTSQLQN
NT seq 525 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaatgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtggacgagatgaagctgaaagctcacaaatattccatcgtcatc
gcactctgggtgagcctggcggctttcgtgatgctcctcttcctcattctgctctacatg
tcctggtcgggctccccgcagatgaggaacagccccaagcaccatcaaacatgcctctgg
agtcacagcctcaaccttcacctctgcatccagaagtgcctgccatgccgctaccgcagg
gaacccctggggacctcacaggctctggtgcgctcagtggagccagggagcagaactggc
tctgaccagccgctacgacaggagagctcctccaccttgcgcccgggggtcttccagacc
caatccactctcttctgggaaatgaccctcgatgggggtcctctcgtcaggagcaagccc
agggagcctccccctggagacaggacctctcagttgcagaactga

DBGET integrated database retrieval system