KEGG   Salmonella bongori serovar 48 z41 --: N643_09285
Entry
N643_09285        CDS       T03249                                 
Name
(GenBank) LPS biosynthesis protein WbpG
  KO
K24259  putative aminotransferase
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00541  O-Antigen nucleotide sugar biosynthesis
sbv01100  Metabolic pathways
sbv01250  Biosynthesis of nucleotide sugars
Module
sbv_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    N643_09285
SSDB
Motif
Pfam: NAD_synthase Asn_synthase QueC ATP_bind_3 tRNA_Me_trans Xre-like-HTH
Other DBs
NCBI-ProteinID: AID27304
LinkDB
Position
complement(1961401..1962543)
AA seq 380 aa
MKKDNYQICRHCIMDTTDPNINFNDKGECDYCTNYENNIFPAWIKGSSSEFFLSEMANKI
KADAKNSDFDCIIGLSGGLDSSYAAYIAKEKMGLRPLLFHVDAGWNTDQAVGNIEKLIEG
LGLDLYTEVVNWEEMKDLQLSFLKSGIPDQDLVQDASFFSALYKFARQHRIKHVITGSNY
STECCREPEEWGGYLGIDTLLFNDIHKKFGKRQLKSFPLVDILVYKLFYQKILGMKVHHP
LNLVPFNKKNAENELKEKFGWQPFQHKHHESRFTRFYEDYWLPRRFGFEKRRAHFSSLIM
TGQMTREEALERISKPEMDEHFLKQEFEYVAHKLGITVDELQQLFDMPKKTYKDYKNKRW
LIGLGANVLRTLGLEKRYFR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaaaaagataattatcagatttgtagacattgtattatggatacaaccgatccaaat
atcaattttaatgataaaggggaatgtgattattgcactaattatgaaaataatatattc
cctgcatggataaaaggttcttcttcggaattttttttatctgaaatggcaaataaaata
aaagctgatgctaaaaatagtgattttgattgcattattggtttgtcaggagggctagac
agctcttatgctgcatatattgcgaaagaaaaaatgggattaaggcctcttttattccat
gttgatgcaggatggaatacagatcaagctgtaggcaatattgaaaaacttattgaaggg
cttggtttagacctctatacagaggttgttaattgggaggaaatgaaagacttacagctt
tcctttttaaagtctggtattcctgatcaggatttagttcaggatgcatcctttttttct
gccttatataaatttgctcgccaacatagaatcaaacatgtcatcactggttctaattat
tcgacagaatgttgtcgtgagccagaggaatggggtgggtatttaggtatcgatacctta
ttatttaatgatattcataaaaaatttggtaagcgacagttaaaatcatttccattagtt
gatatattagtatacaaattgttttaccagaaaattcttggcatgaaagtgcatcaccca
ctgaacttagttccctttaataaaaaaaatgcagaaaatgaactgaaagagaaatttggt
tggcaacccttccagcataaacatcatgaatctcgttttactcgtttctatgaagactat
tggctaccacgtagattcggcttcgagaaaagaagagcgcatttttcaagtttaattatg
actggtcaaatgacccgggaagaagcattagagagaatttcaaaacctgaaatggatgag
cattttcttaaacaggagtttgagtatgtagcgcataaactcggtattactgtagatgaa
ttacaacaactttttgatatgcctaaaaaaacctacaaagattataaaaataaacgttgg
ctaatagggcttggggcaaatgtgctgcgtactcttggattagaaaaaaggtattttaga
tga

DBGET integrated database retrieval system