KEGG   Salmonella bongori N268-08: A464_2216
Entry
A464_2216         CDS       T02733                                 
Name
(GenBank) putative LPS biosynthesis protein
  KO
K24259  putative aminotransferase
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00541  O-Antigen nucleotide sugar biosynthesis
sbz01100  Metabolic pathways
sbz01250  Biosynthesis of nucleotide sugars
Module
sbz_M00923  UDP-L-FucNAm biosynthesis
Brite
KEGG Orthology (KO) [BR:sbz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A464_2216
SSDB
Motif
Pfam: NAD_synthase Asn_synthase QueC ATP_bind_3 tRNA_Me_trans
Other DBs
NCBI-ProteinID: AGR59401
UniProt: S5MRS1
LinkDB
Position
complement(2189734..2190876)
AA seq 380 aa
MKKDNYQICRHCIMDTTDPNINFNDKGECDYCTNYENNIFPAWTKGSSSEYFLSEMANKI
KADAKNSDFDCIIGLSGGLDSSYAAYIAKEKMGLRPLLFHVDAGWNTDQAVGNIEKLIEG
LGLDLYTEVVNWEEMKDLQLSFLKSGIPDQDLVQDASFFSALYKFARQHRIKHVITGSNY
STECCREPEEWGGYLGIDTLLFNDIHKKFGKRQLKSFPLVDILVYKLFYQKILGMKVHHP
LNLVPFNKKNAENELKEKFGWQPFQHKHHESRFTRFYEDYWLPRRFGFEKRRAHFSSLIM
TGQMTREEALERISKPEMDEHFLKQEFEYVAHKLGITIDELQQLFDMPKKTYKDYKNKRW
LIGLGANVLRTLGLEKRYFR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaaaaagataattatcagatttgtagacactgtattatggatacaaccgatccaaat
atcaattttaatgataaaggggaatgtgattattgcactaattatgaaaataatatattc
cctgcatggaccaaaggttcttcttcggaatattttttatctgaaatggcaaataaaata
aaagctgatgctaaaaatagtgattttgattgcattattggtttgtcaggagggctagac
agctcttatgctgcatatattgcgaaagaaaaaatgggattaaggcctcttttattccat
gttgatgcaggatggaatacagatcaagctgtaggtaatattgaaaaacttattgaaggg
cttggtttagacctctatacagaggttgttaattgggaggaaatgaaagacttacagctt
tcctttttaaagtctggtattcctgatcaggatttagttcaggatgcatcctttttttct
gccttatataaatttgctcgccaacatagaataaaacatgtcatcactggttctaattat
tcgacagaatgttgtcgtgagccagaggaatggggtgggtatttaggtatcgatacctta
ttatttaatgatattcataaaaaatttggtaagcggcagttaaaatcatttccattagtt
gatatattggtatacaaattgttttaccagaaaattcttggcatgaaagtgcatcaccca
ctgaacttagttccctttaataaaaaaaatgcagaaaatgaactgaaagagaaatttggt
tggcagcccttccagcataaacatcatgaatctcgttttactcgtttctatgaagactat
tggctaccacgtagattcggcttcgagaaaagaagagcgcatttttcaagtttaattatg
actggtcaaatgacccgggaagaagcattagagagaatttcaaaacctgaaatggatgag
cattttcttaaacaggagtttgagtatgtagcgcataaactcggtattactatagatgaa
ttacaacaactttttgatatgcctaaaaaaacctacaaagattataaaaataaacgttgg
ctaatagggcttggtgcaaatgtgctgcgtactcttggattagaaaaaaggtattttaga
tga

DBGET integrated database retrieval system