KEGG   Stomoxys calcitrans (stable fly): 106090572
Entry
106090572         CDS       T07664                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
scac  Stomoxys calcitrans (stable fly)
Pathway
scac00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:scac00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106090572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:scac00199]
    106090572
Enzymes [BR:scac01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106090572
Cytochrome P450 [BR:scac00199]
 Cytochrome P450, animal type
  CYP306 family
   106090572
SSDB
Motif
Pfam: p450 DUF4616
Other DBs
NCBI-GeneID: 106090572
NCBI-ProteinID: XP_013112261
UniProt: A0A1I8Q199
LinkDB
Position
Unknown
AA seq 393 aa
MELTSLQLFGIFLALVIAAVWTLFLRVRHQPPGPMGLPLVGYLPFIDSKAPHKTLQELAM
KYGPIYKLKMGSINTIVVSDAALVREFLKREEFTARAPLYVTHGIMGGYGLICSEGPLWR
DQRRHTIDWLKSLGMSKKFGEIRTSLEQRILKGVHECVQCLQNDSENFSVPVNTLPALQH
TLGNIMNDLVFGITYARDDVTWRYLQELQETGVKLIGVSGVVNFLPFLRFLPTNQNNIKF
LLEGKEKTHKIYDDIIRKCESKLQARKFSPTRENMKNTCILEWFLEQREELRNHVDPYHR
SKCDEYFCDSQLRHLLADLFGAGVDTTLSTLRWFLLYMAKEQDIQMRLREDLLTLPKDKV
TLNDLESMDYLRACISEVQRIRSVVPLGIPHGC
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggagttgacatcgttgcaactctttggcatttttctggccttagtcattgctgcggta
tggacactatttttacgtgtgcgtcatcaaccgccaggacccatgggcttaccgttggtg
ggttatttgccattcatagacagcaaagcaccgcacaagacattgcaggaactggccatg
aagtatggccccatatacaaactgaaaatgggtagtatcaacactattgttgtatcggat
gctgcattggtgagagaattcttgaagagggaagagttcacagcacgggctcctttatat
gtaacacatggcataatgggtggttatgggttaatatgttccgaaggccctttgtggagg
gatcaacgacgtcacaccattgattggttaaagtcgttaggaatgtctaagaaatttggc
gaaattcgaaccagtcttgagcaacgaattttaaaaggtgtccatgaatgtgtacagtgt
cttcaaaatgattctgagaatttttcggtgcccgtcaatactctgccagcccttcaacac
actttgggcaatattatgaatgatctcgtgtttggcataacctatgcacgcgatgatgtc
acttggcgttatttgcaggagttgcaggaaactggtgttaaacttattggcgtctctgga
gtagtgaattttttgccattcctaagatttttacctaccaatcagaacaacattaaattc
ctacttgaaggcaaggaaaaaacgcataaaatatacgatgatatcatacgaaaatgtgag
agcaaactgcaagcaagaaagtttagcccaacgagagaaaatatgaagaacacttgcatc
ttggaatggtttctggaacagcgcgaggaattgagaaatcatgtcgatccctatcatcgt
tccaaatgtgatgaatacttttgtgattctcaactaagacatcttttggctgatttattt
ggtgctggtgtcgatacaacactgtctacactgcgatggtttctgctgtacatggcaaag
gagcaggatattcaaatgcgattgagagaggatttactaactttgcccaaggacaaggta
accctgaatgatctcgaatctatggattacctgcgtgcctgtatatctgaagtgcagcgt
attagatcggtagtacctttgggcataccacatggctgttga

DBGET integrated database retrieval system