KEGG   Serinus canaria (common canary): 108961333
Entry
108961333         CDS       T05755                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
scan  Serinus canaria (common canary)
SSDB
Motif
Pfam: MRAP PAG
Other DBs
NCBI-GeneID: 108961333
NCBI-ProteinID: XP_030090533
LinkDB
Position
Unknown
AA seq 94 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVTFLFLILLCM
SCSGSTPAKSGLACTTPLTATLKNNASDFSASSQ
NT seq 285 nt   +upstreamnt  +downstreamnt
atggccaacaggacaaactcctccgagtacttctggtcttacgaatattactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatc
gctttctgggtcggcctcgccgccttcgtgacgttccttttcctcattctgctgtgcatg
tcctgctctggatcaacaccagccaagtctggactggcatgcacaactcccctcacggcc
acattgaagaacaatgcatcagatttctcagcgagttcccaataa

DBGET integrated database retrieval system