KEGG   Saccharomyces cerevisiae (budding yeast): YAR007C
Entry
YAR007C           CDS       T00005                                 
Symbol
RFA1, BUF2, FUN3, RPA1, RPA70
Name
(RefSeq) replication factor A subunit protein RFA1
  KO
K07466  replication factor A1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YAR007C (RFA1)
   03420 Nucleotide excision repair
    YAR007C (RFA1)
   03430 Mismatch repair
    YAR007C (RFA1)
   03440 Homologous recombination
    YAR007C (RFA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YAR007C (RFA1)
   03032 DNA replication proteins [BR:sce03032]
    YAR007C (RFA1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YAR007C (RFA1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    YAR007C (RFA1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    YAR007C (RFA1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     YAR007C (RFA1)
   MMR (mismatch excision repair)
     YAR007C (RFA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     YAR007C (RFA1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 tRNA_anti-codon CDC24_OB3 Rep-A_N DUF223 BRCA-2_OB1
Other DBs
NCBI-GeneID: 851266
NCBI-ProteinID: NP_009404
SGD: S000000065
UniProt: P22336
Structure
LinkDB
Position
I:complement(156754..158619)
AA seq 621 aa
MSSVQLSRGDFHSIFTNKQRYDNPTGGVYQVYNTRKSDGANSNRKNLIMISDGIYHMKAL
LRNQAASKFQSMELQRGDIIRVIIAEPAIVRERKKYVLLVDDFELVQSRADMVNQTSTFL
DNYFSEHPNETLKDEDITDSGNVANQTNASNAGVPDMLHSNSNLNANERKFANENPNSQK
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFND
FATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESNVPKTHF
NFIKLDAIQNQEVNSNVDVLGIIQTINPHFELTSRAGKKFDRRDITIVDDSGFSISVGLW
NQQALDFNLPEGSVAAIKGVRVTDFGGKSLSMGFSSTLIPNPEIPEAYALKGWYDSKGRN
ANFITLKQEPGMGGQSAASLTKFIAQRITIARAQAENLGRSEKGDFFSVKAAISFLKVDN
FAYPACSNENCNKKVLEQPDGTWRCEKCDTNNARPNWRYILTISIIDETNQLWLTLFDDQ
AKQLLGVDANTLMSLKEEDPNEFTKITQSIQMNEYDFRIRAREDTYNDQSRIRYTVANLH
SLNYRAEADYLADELSKALLA
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgagcagtgttcaactttcgaggggcgattttcatagcatcttcaccaataagcaaagg
tacgataatcccaccggtggcgtttatcaagtttataacaccaggaaatctgatggggct
aacagcaacagaaagaatttgatcatgatttccgatggtatttaccatatgaaggctctg
ttgagaaaccaagctgcatccaagttccagtcaatggaactacaaaggggtgatatcatt
cgcgtgataattgcagaacctgctattgtcagggaaagaaagaaatacgttcttttagta
gatgactttgagttggtccagtcgcgtgctgatatggtcaaccaaactagtacttttttg
gataactatttctcagagcatccaaatgaaaccttaaaagacgaagatataactgacagt
ggtaatgttgccaatcaaacaaacgccagcaatgctggtgtccctgatatgctgcattca
aactcaaacttgaatgcaaatgagagaaaattcgccaatgaaaaccctaattcgcaaaaa
accagaccaatttttgccatcgaacaactgtctccataccaaaacgtttggactatcaaa
gcaagagtttcctacaagggagaaattaaaacgtggcacaatcaaagaggtgatggtaaa
ctattcaatgtcaacttcttggatacctctggagaaatccgagccacggcgtttaatgat
tttgctacaaaatttaacgaaattttacaagaaggcaaagtatactatgtatcaaaggca
aaactccaaccagctaagccccaatttactaatctaacacacccttatgaactgaatttg
gatagagacactgttatagaagaatgtttcgatgaaagtaatgttccgaaaacccatttc
aatttcatcaaactagatgctattcagaaccaggaagtaaattccaacgtagacgtcctc
ggtattatccaaactataaacccacattttgagctaacttcaagggctgggaagaaattc
gatcgtcgtgacatcacaattgttgacgactctgggttttctatctctgttggcctatgg
aatcagcaagcccttgatttcaaccttcctgaaggttctgttgctgccattaaaggtgtt
cgtgtgacggattttggtggcaaatctttgtctatgggattttctagtaccctgattccg
aatccagaaattcctgaggcatatgccttaaagggttggtatgattccaagggccgcaac
gcaaacttcatcactttaaagcaagaacccggtatgggtggtcaatcggctgctagctta
acaaaattcattgctcagcgtattactattgctagagctcaagctgaaaatctaggaaga
agcgagaaaggtgacttttttagtgttaaagctgctataagtttcttaaaagttgataat
tttgcatatcctgcctgttctaatgagaattgtaataagaaagttctggaacagcctgat
ggtacttggagatgtgagaagtgcgacaccaataatgcaaggccaaattggagatacatc
ttgacaatatcaattattgacgaaaccaatcaactatggctcactttatttgacgaccaa
gctaaacaattattgggtgttgatgctaatacattaatgtctttgaaggaagaagacccc
aacgaattcacaaaaattactcaaagtatccaaatgaacgaatatgactttaggattaga
gcgcgtgaggatacatacaatgatcaaagcagaattagatataccgttgctaacctacac
agcttgaattacagggctgaagccgactatcttgccgatgagttatccaaggctttgtta
gcttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL312W
Entry
YNL312W           CDS       T00005                                 
Symbol
RFA2, BUF1, RPA2, RPA32
Name
(RefSeq) Rfa2p
  KO
K10739  replication factor A2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YNL312W (RFA2)
   03420 Nucleotide excision repair
    YNL312W (RFA2)
   03430 Mismatch repair
    YNL312W (RFA2)
   03440 Homologous recombination
    YNL312W (RFA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL312W (RFA2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL312W (RFA2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    YNL312W (RFA2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     YNL312W (RFA2)
   MMR (mismatch excision repair)
     YNL312W (RFA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     YNL312W (RFA2)
SSDB
Motif
Pfam: tRNA_anti-codon RPA_C HTH_IclR CDC24_OB3
Other DBs
NCBI-GeneID: 855404
NCBI-ProteinID: NP_014087
SGD: S000005256
UniProt: P26754
Structure
LinkDB
Position
XIV:join(48287..48293,48402..49216)
AA seq 273 aa
MATYQPYNEYSSVTGGGFENSESRPGSGESETNTRVNTLTPVTIKQILESKQDIQDGPFV
SHNQELHHVCFVGVVRNITDHTANIFLTIEDGTGQIEVRKWSEDANDLAAGNDDSSGKGY
GSQVAQQFEIGGYVKVFGALKEFGGKKNIQYAVIKPIDSFNEVLTHHLEVIKCHSIASGM
MKQPLESASNNNGQSLFVKDDNDTSSGSSPLQRILEFCKKQCEGKDANSFAVPIPLISQS
LNLDETTVRNCCTTLTDQGFIYPTFDDNNFFAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcaacctatcaaccatataacgaatattcatcagtaacgggcggtggctttgagaac
tctgagtcccgcccaggtagtggggagtcggaaactaacactagagttaacaccttgaca
cctgtgacgatcaaacaaattctagagtccaaacaggatattcaggacggccccttcgtt
tcgcataaccaagaacttcatcacgtttgttttgtaggtgtggtgagaaacattacagac
catactgcaaatatttttttaactattgaggatggaactggtcaaatagaagtgagaaaa
tggagcgaagatgcaaatgacttggctgccggtaacgatgactcttctggtaaaggttat
ggttcgcaagtcgcccaacaatttgaaattggcggttacgtaaaagtttttggtgctttg
aaagagtttggtggtaagaaaaatatacagtatgcggtgattaagcccatagattcattc
aatgaagtgttgacgcatcacttggaagtcatcaaatgtcattccatagccagtggaatg
atgaaacaacctttggagagtgcatccaacaacaatgggcaatcattatttgtcaaggat
gataacgatacatcttccggctccagtccgttacaaagaattctagaattttgtaagaag
caatgtgagggcaaagacgctaattcattcgctgttcccattccattgatctcgcaatcc
ttgaatttggatgaaactaccgtcagaaactgctgtacgaccttgactgaccagggtttt
atctacccaacttttgatgacaataacttctttgccctatga

DBGET integrated database retrieval system