KEGG   Saccharomyces cerevisiae (budding yeast): YBL023C
Entry
YBL023C           CDS       T00005                                 
Symbol
MCM2
Name
(RefSeq) MCM DNA helicase complex subunit MCM2
  KO
K02540  DNA replication licensing factor MCM2 [EC:5.6.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBL023C (MCM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBL023C (MCM2)
   04113 Meiosis - yeast
    YBL023C (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBL023C (MCM2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBL023C (MCM2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     YBL023C (MCM2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBL023C (MCM2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    YBL023C (MCM2)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA AAA_30 bpMoxR
Other DBs
NCBI-GeneID: 852258
NCBI-ProteinID: NP_009530
SGD: S000000119
UniProt: P29469
Structure
LinkDB
Position
II:complement(174920..177526)
AA seq 868 aa
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgtctgataatagaagacgtagacgtgaggaagatgattcggactcagaaaatgagcta
ccgccatcctcacctcagcaacattttagaggggggatgaacccagtttcatcacctatt
ggttctccagatatgattaaccctgaaggtgacgataatgaagttgacgatgtaccagat
attgatgaagttgaagaacaaatgaacgaagtagatttgatggacgataatatgtatgag
gattatgcggctgatcataatagagatagatatgatccagatcaagttgacgacagggaa
caacaagaactatctttaagcgaacgtcgccgcattgatgctcaactaaatgaaagagat
aggctattgagaaatgttgcctacatagatgacgaggacgaagaacaagaaggtgcagcg
caacttgatgaaatgggccttcctgtgcaaagacgaagaaggagaaggcagtatgaggac
ttagagaatagtgatgacgatctattgagtgacatggacattgacccattaagagaagaa
cttactttagaatctctgagtaacgttaaggctaacagttactcggaatggataacacaa
cctaatgtctcaagaactattgccagagagttaaaatcattcctgctggaatatacagat
gaaacgggtcgttctgtatatggtgcacgtattagaacattaggtgaaatgaattctgaa
tctttggaggttaattatagacacttagcggagtccaaagccatcctggcactattttta
gctaaatgtccagaagaaatgttgaaaatattcgatctcgtggctatggaggcaacagaa
ttgcattacccagattatgcccgtattcactccgaaattcacgtaagaatctctgatttt
ccaacaatatacagtttacgtgaattgcgtgagtctaatttgtcctctctagtacgcgtc
actggggtggtgacaagaagaacaggagtcttccctcaattaaaatatgtcaaattcaat
tgtttgaaatgtggctccattttgggcccattttttcaagattctaatgaagaaattaga
atctcattctgtacaaactgcaaatcaaaaggtccctttagagtcaatggagaaaaaact
gtgtaccgaaattatcaaagggttacgctccaggaagctcccggaaccgttcctccaggc
cgtctaccaagacatagagaagtcattttgttggcggatttggtagatgtatccaagcca
ggtgaagaggtagaagttaccggcatctacaaaaataactacgatggtaacttgaatgca
aagaacggattccccgtttttgcaacaattatcgaggcaaattctataaaaagaagagag
ggcaatacagctaacgaaggcgaagaagggttggatgttttcagttggactgaagaagaa
gaacgtgaatttagaaagatttctagggatcgtggtataattgataaaattatatcatcg
atggcaccgtctatctatggtcatagagatattaaaactgcagtcgcgtgctcattattt
ggaggtgttccaaaaaacgtcaatggaaaacattctattcgtggtgatatcaatgtgtta
ttattaggtgatccaggtactgccaaatctcaaatcttaaaatacgtcgagaaaacagcg
catagagcggtctttgcaactggtcagggtgcttcggctgtcggtctgacagcatccgtc
agaaaagatcctattactaaagaatggaccttagaagggggggcgctagtattggctgat
aagggtgtttgtttaattgatgaattcgataagatgaacgatcaggatcgtacatctatt
catgaggctatggaacagcaaagtatttccatttccaaggccggtattgttactacatta
caagcgcgctgctcaattattgctgcggcaaatcctaatggtggtagatataattcaacc
ttgcctttagctcagaatgttagtttgaccgagcctattctgtctagatttgatatttta
tgtgttgtcagagaccttgttgatgaagaggcagacgaaagattggccacatttgttgtc
gattctcatgtaagatctcatccagaaaacgatgaagatcgagaaggcgaagagcttaaa
aataatggcgaatcggcgatagaacaaggagaagatgaaataaatgagcagcttaatgca
aggcaaagaagacttcaaagacaaaggaagaaggaggaagagatctcgcctattccacag
gaattattgatgaaatatattcactatgcgaggacaaaaatataccctaaattgcatcag
atggatatggataaggttagcagggtatatgcggatttgagaagagaaagtatttctaca
ggttcgtttccaatcacagttcgtcatttagaatctattctaagaattgcagaatctttt
gctaaaatgagattatctgaatttgtgtcttcttatgatttggatagagctatcaaagtt
gtagttgattcctttgttgatgcccaaaaagtcagtgttcgccgccaactccgcaggtct
ttcgcaatttataccttgggtcactaa

DBGET integrated database retrieval system