KEGG   Saccharomyces cerevisiae (budding yeast): YBR073W
Entry
YBR073W           CDS       T00005                                 
Symbol
RDH54, TID1
Name
(RefSeq) DNA-dependent ATPase RDH54
  KO
K10877  DNA repair and recombination protein RAD54B [EC:5.6.2.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YBR073W (RDH54)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR073W (RDH54)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     YBR073W (RDH54)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     YBR073W (RDH54)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII HDA2-3 DUF2439
Other DBs
NCBI-GeneID: 852365
NCBI-ProteinID: NP_009629
SGD: S000000277
UniProt: P38086
LinkDB
Position
II:383112..385988
AA seq 958 aa
MAVISVKPRRREKILQEVKNSSVYQTVFDSGTTQMQIPKYENKPFKPPRRVGSNKYTQLK
PTATAVTTAPISKAKVTVNLKRSISAGPTLNLAKKPNNLSSNENTRYFTIMYRKPTTKKH
KTWSGDGYATLKASSDKLCFYNEAGKFLGSSMLPSDSDSLFETLFKAGSNEVQLDYELKE
NAEIRSAKEALSQNMGNPSPPTTSTTETVPSTKNDGGKYQMPLSQLFSLNTVKRFKSVTK
QTNEHMTTVPKTSQNSKAKKYYPVFDVNKIDNPIVMNKNAAAEVDVIVDPLLGKFLRPHQ
REGVKFMYDCLMGLARPTIENPDIDCTTKSLVLENDSDISGCLLADDMGLGKTLMSITLI
WTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGVLTLS
SRNSPDMDKMAVRNFLKVQRTYQVLIIGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNG
ASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFKRRFIIPITRA
RDTANRYNEELLEKGEERSKEMIEITKRFILRRTNAILEKYLPPKTDIILFCKPYSQQIL
AFKDILQGARLDFGQLTFSSSLGLITLLKKVCNSPGLVGSDPYYKSHIKDTQSQDSYSRS
LNSGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQR
DSIVTSFNRNPAIFGFLLSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQK
KPCFIYRLVTTGCIDEKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSV
HTDTKSNTHDLICSCDGLGEEIEYPETNQQQNTVELRKRSTTTWTSALDLQKKMNEAATN
DDAKKSQYIRQCLVHYKHIDPARQDELFDEVITDSFTELKDSITFAFVKPGEICLREQ
NT seq 2877 nt   +upstreamnt  +downstreamnt
atggcggtaataagcgttaaacctcgacgaagagagaagatcctacaggaggtaaaaaac
agctcggtatatcaaacggtatttgattccggtactactcaaatgcagataccgaaatat
gagaacaagccattcaagcctccaagaagggttggatcaaataagtacacacaactcaaa
ccaaccgccactgcagtcacaacagcccctatatctaaagccaaagttactgtcaacttg
aaaagaagcatttcggcgggacctactttaaatcttgccaagaagccgaataatctgtcc
tcaaatgaaaacactagatattttactatcatgtacaggaagcctactaccaaaaagcac
aagacttggagtggtgatggctacgctaccttaaaagccagtagcgataagttatgcttt
tataacgaagcagggaaatttcttgggtcaagtatgctaccaagtgattcagattctctc
ttcgaaactcttttcaaagcaggctccaatgaagtacaattggattacgaattgaaggaa
aatgcagaaatacgtagcgccaaagaagccttatcacaaaacatgggaaatcccagccca
ccgaccacaagcacaacagaaacagtgccttctacgaagaatgacggtggcaaataccaa
atgcctctgtctcagctgttttcactaaacactgtgaaaagattcaaatcagtaacaaag
caaacaaatgaacacatgaccacagtacctaaaaccagtcaaaattccaaagccaaaaaa
tattatccagtatttgatgtcaacaaaatcgataatcctatagtaatgaacaaaaatgca
gccgctgaagttgacgtaattgttgatccattactgggcaaattcttgcgccctcatcag
agggaaggggtgaagttcatgtatgattgcttaatgggcttggcaagaccaactattgaa
aatccggatatcgattgtactactaaaagtttagtgttagaaaatgactcagatattagt
ggatgccttttggctgatgatatgggtttaggtaaaacactaatgagtataactttgatt
tggacattaattaggcaaactccttttgcatcaaaagtttcatgttcgcaatcaggcata
ccattaactggactttgtaagaagattttagtcgtttgtcccgttactttaataggaaat
tggaaaagagaatttggaaaatggttaaatttgtcaagaataggtgttttgacattaagc
tcaaggaattctcctgatatggataaaatggctgtcagaaattttttaaaagtgcaacga
acttatcaagtcttgattattggctacgaaaaactcttgagtgtttctgaagaattagag
aaaaataaacatttgattgacatgctggtgtgtgacgaaggccatcgactaaaaaacggg
gcttctaaaattttaaatacgctgaagagtttagacataagaaggaagcttttgcttacg
ggaactcctatacaaaatgatcttaatgagtttttcactattatagatttcataaaccca
ggaatccttggaagcttcgcttctttcaaaagaagattcattatccctataactagagcc
agagacactgcaaacagatacaacgaagaattgttggaaaagggggaagaaaggtcaaaa
gagatgatagaaattacgaaaagatttattttgagacgaacaaatgcgattttagaaaag
taccttcctccaaagacggatataattttattctgtaaaccatacagccaacagatattg
gcattcaaagatattttgcagggcgcacgtttagattttggacaattgacgttcagttct
tcgctaggactaataacattactgaaaaaggtttgtaactctcctggattggttggctca
gatccctattacaaatcacatataaaggatacccaatctcaggacagctatagtcgttct
ttgaactctggtaagttaaaggtattaatgacattactagaaggtattaggaagggtacc
aaggagaaggtcgtcgtagtgtctaactacactcaaacattggatataattgaaaatttg
atgaatatggctgggatgtcacattgcagactcgacggttccatacctgctaaacaaagg
gactctatcgtcacatctttcaatcggaatccagccatatttggattcttgttgagtgca
aaatcgggaggtgtaggattgaatctagtcggtgcttcgcgacttattttatttgataat
gattggaatccttcagtagatttgcaagcgatgtcacgaattcatagagatggtcaaaaa
aagccgtgcttcatatatagacttgtcacaactgggtgtatcgatgagaaaatattgcaa
aggcaattaatgaagaacagtttgagccaaaaatttctaggtgactcggagatgagaaat
aaagaatcttctaatgatgatcttttcaataaagaggacttgaaggacctgttttctgtc
catacagataccaagagtaacacacatgacttaatttgttcttgcgatggtttaggtgag
gaaattgaatatcctgaaacaaatcaacagcagaacaccgtagagctgagaaagcgtagc
actacgacatggacaagtgcgctggatttacaaaagaaaatgaatgaagcagccaccaac
gatgatgccaaaaagtcacaatacattaggcaatgtctcgttcattataagcatatcgat
ccagcaagacaagatgaattatttgatgaggttatcacagattcgttcaccgaattgaaa
gatagtattacctttgcgtttgtaaagcccggcgagatatgtctcagagaacaatga

KEGG   Saccharomyces cerevisiae (budding yeast): YGL163C
Entry
YGL163C           CDS       T00005                                 
Symbol
RAD54, XRS1
Name
(RefSeq) DNA-dependent ATPase RAD54
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YGL163C (RAD54)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YGL163C (RAD54)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     YGL163C (RAD54)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     YGL163C (RAD54)
SSDB
Motif
Pfam: SNF2-rel_dom Rad54_N Helicase_C ResIII HDA2-3 Exo_endo_phos_3
Other DBs
NCBI-GeneID: 852713
NCBI-ProteinID: NP_011352
SGD: S000003131
UniProt: P32863
LinkDB
Position
VII:complement(193707..196403)
AA seq 898 aa
MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS
DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL
SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE
MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR
ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF
NTSSEDPLKSDEKALTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK
RLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQA
QGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRV
ILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQL
QKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVG
GSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSIL
ERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFND
PEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRF
ISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHC
KRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNEHHYNDISFAFQYISH
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggcaagacgcagattaccagacagaccaccaaatggaataggagccggtgaacggccg
agactggtacctaggcctattaacgtacaagactcggtgaaccgactaacgaaaccgttc
agggtcccgtacaagaacacgcacatcccgcccgctgctggtagaatcgccaccgggtct
gataatatcgtaggaggaaggagcttgaggaaaagatcagcgactgtatgttattccggc
ttggatataaatgcggacgaagcagagtacaacagccaagacataagtttttctcagttg
actaaacgacggaaggatgctcttagtgctcaaaggttggccaaggatccgacaagactg
agtcatatccagtacactttgagaagatctttcactgtgccaatcaagggatatgtacaa
agacacagtctgccattaacgttaggaatgaaaaaaaaaattactccagaacctcgacct
ctacatgaccctacagacgaatttgccatagtgctttatgacccgtccgttgacggtgaa
atgattgtccatgacacatctatggataacaaggaagaagaatcaaagaaaatgatcaaa
agcacacaggaaaaggataatattaacaaggaaaagaatagccaggaagaaagacccaca
caaagaataggacgccatccagctttgatgacaaatggtgtgagaaacaaaccgttacgt
gagctactcggtgattcggaaaactctgcggaaaacaagaagaaatttgctagtgtccct
gtggttattgatccaaaactggccaagattttaagaccccatcaagtcgaaggggtgaga
ttcttataccgttgtgtcacagggcttgtcatgaaagattacttagaagctgaggcgttc
aacacttcaagcgaagatcccttaaagagcgacgagaaggcacttactgaatctcaaaag
actgaacaaaacaatagaggggcctacggctgcatcatggccgatgaaatggggctgggt
aagacattgcagtgtatagcacttatgtggacattattaagacagggcccgcagggtaaa
agacttatcgacaaatgtatcattgtttgtccatcttctttagtcaacaactgggctaat
gaattgataaaatggttgggtcccaatactctaactccgttagcggttgatgggaaaaaa
tcttcaatgggtggtggtaatacaacagtttcgcaagctattcatgcctgggctcaggca
cagggaagaaatattgttaagcccgttttaatcatatcgtatgaaacattacgtcgaaat
gttgatcaattgaaaaactgcaatgtgggtttaatgctggcagatgaagggcaccgtttg
aaaaacggtgactctttaacattcacagctttggatagcatcagttgtcctagaagagtt
atattatctggtacacccattcaaaacgatctttccgaatattttgctctactgagtttt
tcgaatcctggcttattaggttccagagcagaatttaggaaaaattttgagaatccaatt
ttgcgagggcgtgatgctgatgctactgataaagaaatcacaaagggcgaggcgcaatta
cagaagctatctaccattgtctccaaatttattatccgtcgtactaacgatattttggcc
aaatatttgccttgcaagtatgagcacgttattttcgtaaacttgaagccgttgcagaac
gagctctacaataaattaattaagtcaagagaagtgaaaaaagtagtaaaaggtgttggt
gggtctcagcccctgagggctattggtattttaaagaagctatgtaatcaccctaatctc
ttgaattttgaagatgaatttgacgatgaagatgatttggaactacctgacgattataat
atgccgggttcaaaagccagggacgtacaaacaaaatattcagctaaattttccattttg
gaaagatttctccataagataaagaccgaatccgatgataagattgttttgatctccaac
tatacccaaaccttggacctcattgaaaaaatgtgtagatataagcactacagtgctgta
cggttggatggtacaatgtcaattaacaaaagacaaaaattggtggataggttcaacgat
cctgaaggccaagagttcatcttcctcttaagttctaaagcaggtgggtgtggtatcaat
ttgattggtgcaaatcgattaattttgatggatccggattggaatcctgctgctgatcaa
caagctttggcacgtgtttggagagacggtcaaaaaaaggattgtttcatttacagattc
atatcgactggtaccatagaggaaaaaatctttcaaagacaatctatgaaaatgagtttg
agttcatgcgtggtcgatgcgaaagaagacgttgaaaggttgtttagttctgacaattta
agacagttgtttcaaaaaaatgagaatacgatatgtgaaacacacgaaacataccattgt
aaacgttgtaatgctcagggtaaacaattaaagagagcccctgcaatgttatatggtgat
gcgacaacttggaatcatttgaaccatgacgcattggaaaaaacaaatgatcatctacta
aaaaacgagcatcattacaatgatatcagttttgcatttcaatatatttcacattga

DBGET integrated database retrieval system