KEGG   Saccharomyces cerevisiae (budding yeast): YBR082C
Entry
YBR082C           CDS       T00005                                 
Symbol
UBC4
Name
(RefSeq) E2 ubiquitin-conjugating protein UBC4
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YBR082C (UBC4)
   04120 Ubiquitin mediated proteolysis
    YBR082C (UBC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YBR082C (UBC4)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     YBR082C (UBC4)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   YBR082C (UBC4)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 852376
NCBI-ProteinID: NP_009638
SGD: S000000286
UniProt: P15731
Structure
LinkDB
Position
II:complement(join(406628..407027,407123..407169))
AA seq 148 aa
MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTD
YPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAHIYKTDRPKYEATAREWTKKYAV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtcttcttctaaacgtattgctaaagaactaagtgatctagaaagagatccacctact
tcatgttcagccggtccagtcggcgatgatctatatcactggcaagcatccatcatggga
cctgccgattccccatatgccggcggtgttttcttcttgtctatccatttcccaaccgac
tacccattcaagccaccaaagatctccttcacaaccaagatatatcatccaaatatcaat
gccaatggtaacatctgtctggacatcctaaaggatcaatggtctccagctctaactcta
tcgaaggtcctattatccatctgttctttgttaacagacgctaatcctgacgatccttta
gtaccagaaatcgctcatatctacaagactgacagacccaagtacgaagctacagccaga
gaatggacaaagaaatacgctgtataa

KEGG   Saccharomyces cerevisiae (budding yeast): YDR059C
Entry
YDR059C           CDS       T00005                                 
Symbol
UBC5
Name
(RefSeq) E2 ubiquitin-conjugating protein UBC5
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR059C (UBC5)
   04120 Ubiquitin mediated proteolysis
    YDR059C (UBC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR059C (UBC5)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     YDR059C (UBC5)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   YDR059C (UBC5)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 851631
NCBI-ProteinID: NP_010344
SGD: S000002466
UniProt: P15732
LinkDB
Position
IV:complement(join(569234..569633,569724..569770))
AA seq 148 aa
MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD
YPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAQIYKTDKAKYEATAKEWTKKYAV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtcttcctccaagcgtattgccaaggaattaagtgatttagggagagatcctcctgct
tcatgttcagcaggacctgtaggggatgacctgtatcattggcaagcctctattatgggt
ccttcagactcaccctacgctggtggcgttttctttttgtctattcactttccaactgat
tatccattcaagccaccgaaggtaaactttacgaccaaaatttatcatccgaatattaat
tcgagtggtaatatctgccttgatattttaaaggaccagtggtcaccggcgctaaccctt
tcaaaagttttgttgtctatttgctctcttttaacagatgctaatcccgacgatcctttg
gtccctgaaattgctcaaatctacaagacagataaggctaagtatgaagccaccgctaag
gagtggactaaaaaatatgctgtttga

DBGET integrated database retrieval system