KEGG   Saccharomyces cerevisiae (budding yeast): YBR098W
Entry
YBR098W           CDS       T00005                                 
Symbol
MMS4, SLX2, YBR100W
Name
(RefSeq) Mms4p
  KO
K10882  crossover junction endonuclease EME1 [EC:3.1.22.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YBR098W (MMS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR098W (MMS4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-
     YBR098W (MMS4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     YBR098W (MMS4)
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 852395
NCBI-ProteinID: NP_009656
SGD: S000000302
UniProt: P38257
LinkDB
Position
II:441515..443590
AA seq 691 aa
MSQIVDFVEDKDSRNDASIQIIDGPSNVEIIALSESMDQDECKRAHVSSAEMIPSSPQRK
SVSNDVENVDLNKSIELSAPFFQDISISKLDDFSTTVNSIIDSSLRNENNAKGNAKKLLD
DLISDEWSADLESSGKKHNKSQYNLRDIAEKWGVQSLKNPEPIAVDCEYKTQGIGKTNSD
ISDSPKSQIGAADILFDFPLSPVKHENPTEEKHNSIANENSSPDNSLKPAGKQNHGEDGT
SMAKRVYNKGEDEQEHLPKGKKRTIALSRTLINSTKLPDTVELNLSKFLDSSDSITTDVL
STPAKGSNIVRTGSQPIFSNANCFQEAKRSKTLTAEDPKCTKNTAREVSQLENYIAYGQY
YTREDSKNKIRHLLKENKNAFKRVNQIYRDNIKARSQMIIEFSPSLLQLFKKGDSDLQQQ
LAPAVVQSSYNDSMPLLRFLRKCDSIYDFSNDFYYPCDPKIVEENVLILYYDAQEFFEQY
TSQKKELYRKIRFFSKNGKHVILILSDINKLKRAIFQLENEKYKARVEQRLSGTEEALRP
RSKKSSQVGKLGIKKFDLEQRLRFIDREWHVKIHTVNSHMEFINSLPNLVSLIGKQRMDP
AIRYMKYAHLNVKSAQDSTETLKKTFHQIGRMPEMKANNVVSLYPSFQSLLEDIEKGRLQ
SDNEGKYLMTEAVEKRLYKLFTCTDPNDTIE
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgagccagatcgttgattttgttgaggacaaagattcaagaaacgatgccagtattcag
atcatcgatggaccctcaaatgttgaaattatcgctctctcggaatcaatggatcaagat
gagtgcaaaagggcacatgtaagctctgcagagatgattccatcatcaccgcaaagaaaa
tctgtttcgaatgatgttgagaatgttgacctaaacaaatctatcgaactttctgcgccg
ttcttccaagatatcagtataagcaagctagatgacttttctacaacagtaaattccatc
atagattcgtctctcagaaatgagaataatgcaaaaggaaacgcgaaaaaacttttggat
gatctaataagtgatgaatggtcagctgatcttgagtcgagtggaaagaagcacaacaaa
tcacaatacaatttgagggacatcgcagagaaatggggagtacagtctttaaaaaatcca
gagcctattgctgttgactgcgaatataagacacaaggaatcggaaaaaccaatagtgac
attagtgatagtccgaaatcacagataggagcagctgatatactgttcgattttccactg
tctccagtaaaacatgagaacccaactgaagaaaagcacaattcgattgctaatgaaaat
tcttcaccagataatagcctgaaaccagcaggaaaacaaaatcatggtgaagatgggaca
tccatggcaaaaagggtatacaataaaggtgaagacgagcaagaacaccttccgaaagga
aagaagagaaccatagcgttatcaagaacactaatcaacagcaccaaactacctgataca
gtagaactaaatctttctaaatttctcgattcctcagatagtattactactgatgtactt
tcaacccctgcaaaggggtctaacatagtaaggacaggtagtcaaccaatctttagcaac
gctaattgttttcaggaagcaaaacgctcgaaaacattaacggctgaggatcccaaatgt
actaaaaatactgccagagaggtatcacaactagagaattatattgcctatgggcaatac
tatactagagaagactcaaaaaacaaaatacgacacttgttaaaagaaaacaaaaatgct
tttaagcgagttaaccagatatatcgagataatataaaagcacgctctcaaatgattata
gagttttcgcctagccttctccagttatttaaaaaaggagacagtgatctgcaacaacaa
ttggcaccagcagttgtgcaatcaagctataacgattctatgccgcttttaagatttctt
cgaaaatgtgacagtatttacgactttagtaacgatttctattacccctgtgatcccaaa
atagttgaagaaaacgttttgattctatattatgatgcgcaagaattttttgaacaatac
acttcacaaaagaaagaattatataggaagatacgatttttctcaaagaatggaaaacat
gtgattcttatactaagcgatataaataaactcaaaagagctattttccaattagaaaat
gaaaagtacaaagctagggtagaacaacgattgtcaggaacagaagaagctttaagaccg
agaagtaaaaaatcaagccaagttggaaaattagggataaaaaaatttgatttagagcaa
cgattgcgcttcattgatagagaatggcatgtcaaaatacatactgtaaattcacatatg
gagtttattaattctctgccgaacctagtgtcattaattggaaaacagcgcatggatccc
gcaattcggtatatgaaatatgctcatttgaatgtaaaatccgctcaggatagtacagaa
acgctaaagaaaacctttcatcagatagggagaatgcctgaaatgaaggcgaataatgtc
gtgagcctataccccagttttcaatcattacttgaagatattgaaaagggaagactgcaa
tcagacaacgaaggtaaatacttgatgactgaggcagtagaaaaaagattgtacaaactg
tttacttgtactgatccaaatgatactattgaatga

DBGET integrated database retrieval system