KEGG   Saccharomyces cerevisiae (budding yeast): YDL127W
Entry
YDL127W           CDS       T00005                                 
Symbol
PCL2, CLN4
Name
(RefSeq) cyclin PCL2
  KO
K06657  PHO85 cyclin-2/9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL127W (PCL2)
SSDB
Motif
Pfam: Cyclin_N Cyclin PX
Other DBs
NCBI-GeneID: 851430
NCBI-ProteinID: NP_010156
SGD: S000002285
UniProt: P25693
LinkDB
Position
IV:234927..235853
AA seq 308 aa
MSNYEALLKFNRKAVSKEMVQYLASTTASIIKIKKTNSMIDIALPAPPLTKFINRLIKHS
NVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEY
TDGLLILREVNTIERELLEYFDWDVTISTDDLITCLSPFLKPIKEEQLYKSQRDCRTLKN
FSAQEKDIVNKTSISHSRSSSNMSIPSLASTSTLSTLESRRSNLSNYSNRIRTLPELHES
NNISDKFSPRTYNIDSKHDNKENRPIPTIKPFNFSKARPVILKTGLNKQIIKEDTKVKKS
NWSNYFKS
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtcaaactacgaagccttgctgaaattcaataggaaggctgtatctaaggaaatggtg
caatatctagcatcgaccacagcttccattatcaaaattaagaagacgaatagtatgata
gatattgcattgccagcaccaccgttgactaaattcatcaacagactgatcaagcattct
aacgttcaaactccgactctgatggctacctctgtatatttggccaaattaagatcaata
ataccgagtaacgtttatggtatagagaccaccaggcatagaatattcttaggttgccta
atattagctgcaaaaacgttaaatgattcctcccctcttaacaaacactgggccgaatat
acggacggccttctcatcctaagggaggttaatactattgaaagggaactattagaatat
tttgattgggacgtcaccatttccacagatgatttaattacatgtctctcgccattcttg
aagcctatcaaagaggagcagttgtacaaatcgcaaagagactgtcgcacgttgaaaaat
ttttctgctcaagaaaaagacatagtaaacaaaacatccatttcccattcgcgctcatcg
tccaatatgtctatcccatctttagcttccacttcgaccctctccacgttggaatctaga
agatcgaatttatccaattatagtaacagaatacgaactttgcccgaactacacgaatcc
aataacattagcgacaagttttctccgcgaacatacaacatagactccaaacacgataac
aaggaaaataggccaataccgacaattaagccttttaattttagtaaagcgcgccctgtg
atcttgaaaactgggttaaacaaacagataataaaagaagatacaaaagtaaagaaatcg
aattggtcaaattacttcaaatcgtga

KEGG   Saccharomyces cerevisiae (budding yeast): YDL179W
Entry
YDL179W           CDS       T00005                                 
Symbol
PCL9
Name
(RefSeq) Pcl9p
  KO
K06657  PHO85 cyclin-2/9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL179W (PCL9)
SSDB
Motif
Pfam: Cyclin_N Cyclin
Other DBs
NCBI-GeneID: 851375
NCBI-ProteinID: NP_010102
SGD: S000002338
UniProt: Q12477
LinkDB
Position
IV:138291..139205
AA seq 304 aa
MISDYDALLQFNKKPVSQEMIQFLATSTASIIKIRENNNPIQGCRPPDLSIFIKNVVIQS
NVQTPTLMATSVYLNKLKSVIPKNVYGINTTRHRIFLGCLILAAKTLNDSSPWNKHWTTY
TEGLLRIREVNTIERELLEYLNWDVRITTPDLIDSLSYFLGPIKEQLFLQRRQEMLLFNA
PSPGQLKEYINHRRPVSHSRTSSAISVPSLTSMATVSTTDSRSSLLAKYQPSLPLVESDN
FNKKNHVPLRNNNDICNNFRAEENIHSVNHIDVTMGSSPVMSHKPTIHQRLNFTRRGWSS
FFKQ
NT seq 915 nt   +upstreamnt  +downstreamnt
atgatttctgactacgatgctcttttgcaattcaacaaaaaacctgtttcgcaagaaatg
attcagttcttagccacttctactgcttccataattaaaatcagggaaaataataatcca
atccaaggatgtcgcccaccagacttatctatcttcattaaaaacgtggtaattcagtca
aatgttcaaacaccaactttaatggccacatcagtttatttaaacaaactgaaaagcgta
ataccaaaaaatgtgtacggtattaacaccacaagacatcggatatttctcggatgcttg
atattagctgccaaaactctgaacgattcttctccctggaacaaacactggaccacgtac
acagaaggtttactcagaatacgtgaggtgaataccatcgaacgagaactattagaatat
ttaaattgggatgtgaggataactacaccggatttgattgattctctttcttacttcctc
gggcctatcaaggaacaactatttttacaaaggagacaagaaatgctgttgttcaatgca
ccaagtcccggccaactgaaagaatatataaatcatagaagaccggtttcgcattctaga
acttcttctgctatatcggttccttcactgacatccatggcaacagtttcgacaacagac
tcaaggtcttctctactggcaaaataccaaccgtccctaccgttggtggaatctgacaac
ttcaacaaaaaaaatcatgtgccgttaaggaataataacgatatctgtaataatttcagg
gcagaggaaaacatacactcagtaaaccatattgatgtaacaatgggaagttcaccagta
atgtcgcataagcccacaattcaccaacggttaaattttacaaggaggggctggtcatcg
tttttcaagcaataa

DBGET integrated database retrieval system