KEGG   Saccharomyces cerevisiae (budding yeast): YDR146C
Entry
YDR146C           CDS       T00005                                 
Symbol
SWI5
Name
(RefSeq) DNA-binding transcription factor SWI5
  KO
K09202  regulatory protein SWI5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR146C (SWI5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YDR146C (SWI5)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    YDR146C (SWI5)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 Bunya_G2 zf-H2C2_2 DUF641 AT_hook
Other DBs
NCBI-GeneID: 851724
NCBI-ProteinID: NP_010430
SGD: S000002553
UniProt: P08153
Structure
LinkDB
Position
IV:complement(748613..750742)
AA seq 709 aa
MDTSNSWFDASKVQSLNFDLQTNSYYSNARGSDPSSYAIEGEYKTLATDDLGNILNLNYG
ETNEVIMNEINDLNLPLGPLSDEKSVKVSTFSELIGNDWQSMNFDLENNSREVTLNATSL
LNENRLNQDSGMTVYQKTMSDKPHDEKKISMADNLLSTINKSEINKGFDRNLGELLLQQQ
QELREQLRAQQEANKKLELELKQTQYKQQQLQATLENSDGPQFLSPKRKISPASENVEDV
YANSLSPMISPPMSNTSFTGSPSRRNNRQKYCLQRKNSSGTVGPLCFQELNEGFNDSLIS
PKKIRSNPNENLSSKTKFITPFTPKSRVSSATSNSANITPNNLRLDFKINVEDQESEYSE
KPLGLGIELLGKPGPSPTKSVSLKSASVDIMPTIPGSVNNTPSVNKVSLSSSYIDQYTPR
GKQLHFSSISENALGINAATPHLKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENE
PESRFVISETPSPVLKSQSKYEGRSPQFGTHIKEINTYTTNSPSKITRKLTTLPRGSIDK
YVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRH
KKSHQEKAYACPCGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSS
VSSSPIKENINKDHNGQLMFKLEDQLRRERSYDGNGTGIMVSPMKTNQR
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggatacatcaaactcttggtttgatgcctcaaaagtacaaagcctaaattttgaccta
caaaccaactcttattactcaaatgctagaggcagtgacccttcgagttatgcaatagaa
ggcgaatataaaacactagcaacagatgatttaggcaatatattgaacctaaactatggt
gaaaccaacgaagttataatgaatgaaataaatgacttaaaccttccgctgggaccactt
tctgatgaaaaatctgtcaaggtttctactttctccgagttaataggaaatgattggcaa
agtatgaactttgacttagaaaataattcaagagaagtgactctaaatgcaactagcttg
ttgaatgaaaatagattaaatcaagacagtggtatgactgtttatcaaaaaacaatgagt
gataagccccacgatgaaaagaagatttccatggcggataatttattgtcgactataaac
aaaagtgaaattaataaaggcttcgatagaaacctcggggaattactgttacagcaacaa
caagagttgcgcgagcaattgagagcacaacaagaggctaataagaagttagagttagaa
ctcaaacaaacacaatacaagcaacaacaactacaggctaccttagagaactctgatggt
ccacagtttttatctcccaaaaggaagatctctcctgcttcagaaaatgtggaggatgta
tacgcaaatagcctttcaccaatgatttccccaccaatgtctaatacttcgttcactggg
tcaccttctaggagaaacaatagacaaaagtactgcctgcagagaaaaaactctagtggt
actgtaggaccactatgtttccaggaattgaacgaaggtttcaatgactccctcatttca
ccaaagaaaattcgctcgaatccaaatgaaaacctcagttcaaaaaccaaatttattacg
cccttcactccaaagagtagagttagttcagctacgtccaactctgctaacattacccct
aataacttaaggttagatttcaagattaatgttgaagatcaggaaagcgaatattcagag
aaacctttgggcctgggtattgaacttcttggaaaaccaggtccttctcctacaaaatca
gtgtctttaaagagtgcttctgtggatattatgcctacaattcctgggtctgtaaataat
actccatcagtcaataaagtatccctttcctccagttatatagaccaatatacaccaaga
ggtaagcagttacactttagctctatcagtgagaatgcattgggtatcaatgctgcgaca
ccacatctaaagccgccgagccagcaagcacgacatcgggaaggcgttttcaatgattta
gaccctaatgtacttacgaaaaatacagacaatgaaggagatgataatgaggaaaatgag
cctgaaagtagatttgttatttccgaaacgccttctcccgttcttaagtcacaaagtaag
tacgaaggaagatctcctcaattcggcacacacattaaggaaatcaacacatataccaca
aatagtccctcaaaaatcacaagaaaactcacaacactgcccagaggttcaatcgataaa
tatgtgaaggaaatgcctgataaaacatttgaatgtttatttcctggatgtacaaaaaca
ttcaagagaaggtataacatcagatctcatattcaaacacatttggaagatcggccatat
tcctgtgatcaccctggatgtgataaggcatttgtacgaaatcatgacttgataagacac
aaaaaatcgcaccaagaaaaggcgtatgcatgtccctgtggtaagaaattcaatagagaa
gacgctttggttgtgcacagaagtagaatgatttgcagcggtggtaaaaagtatgaaaac
gtggtaattaaaaggtctccaagaaaaagaggaagaccaagaaaagatggaacttcaagt
gtttctagtagtccaatcaaagaaaatattaacaaggatcataatggacagttgatgttc
aagcttgaagatcaactcagaagagagcgtagttatgatgggaatggaacggggattatg
gtttcgccaatgaaaactaatcaaaggtaa

DBGET integrated database retrieval system