KEGG   Saccharomyces cerevisiae (budding yeast): YDR177W
Entry
YDR177W           CDS       T00005                                 
Symbol
UBC1
Name
(RefSeq) E2 ubiquitin-conjugating protein UBC1
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR177W (UBC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR177W (UBC1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     YDR177W (UBC1)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   YDR177W (UBC1)
SSDB
Motif
Pfam: UQ_con UBA_3 GGA_N-GAT Calsarcin RGS12_usC
Other DBs
NCBI-GeneID: 851757
NCBI-ProteinID: NP_010462
SGD: S000002584
UniProt: P21734
Structure
LinkDB
Position
IV:816878..817525
AA seq 215 aa
MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM
EYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND
PQDAEVAQHYLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLIDEFESQG
FEKDKIVEVLRRLGVKSLDPNDNNTANRIIEELLK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtctagggctaagagaattatgaaagaaatccaagctgtgaaggatgatcctgcagct
cacattactcttgaatttgtgagtgaatctgatatccaccatttaaaaggcacatttttg
ggcccacctggaacaccttacgagggtggcaaatttgtcgtggatatcgaagtacctatg
gagtatccattcaaaccaccaaagatgcagttcgacacaaaagtataccatccaaatata
tcatcagtgacaggtgccatttgtttagatattcttaagaatgcatggtcgccagtgata
acactaaagtctgcattgatttcgctacaggcgctactacaatctccagagcctaacgat
cctcaagatgcagaagtagcacaacactatttacgggatagagaatcttttaataagact
gctgcactatggacgaggttatacgccagtgaaacttccaatggtcaaaaaggcaatgta
gaggagtctgatttatatgggattgaccacgatctgattgacgagtttgaatctcaaggt
tttgaaaaggacaagattgtggaagtgttgagacgattaggcgtcaagtccttagacccc
aatgacaacaacacagccaaccgtatcatcgaggaattgttgaagtga

DBGET integrated database retrieval system