KEGG   Saccharomyces cerevisiae (budding yeast): YDR180W
Entry
YDR180W           CDS       T00005                                 
Symbol
SCC2
Name
(RefSeq) cohesin-loading factor complex subunit SCC2
  KO
K06672  cohesin loading factor subunit SCC2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR180W (SCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR180W (SCC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    YDR180W (SCC2)
SSDB
Motif
Pfam: Nipped-B_C Cohesin_HEAT CBM_11
Other DBs
NCBI-GeneID: 851761
NCBI-ProteinID: NP_010466
SGD: S000002588
UniProt: Q04002
Structure
LinkDB
Position
IV:821295..825776
AA seq 1493 aa
MSYPGKDKNIPGRIIEALEDLPLSYLVPKDGLAALVNAPMRVSLPFDKTIFTSADDGRDV
NINVLGTANSTTSSIKNEAEKERLVFKRPSNFTSSANSVDYVPTNFLEGLSPLAQSVLST
HKGLNDSINIEKKSEIVSRPEAKHKLESVTSNAGNLSFNDNSSNKKTKTSTGVTMTQANL
AEQYLNDLKNILDIVGFDQNSAEIGNIEYWLQLPNKKFVLTTNCLTKLQMTIKNITDNPQ
LSNSIEITWLLRLLDVMVCNIKFSKSSLKMGLDDSMLRYIALLSTIVLFNIFLLGKNDSN
LHRESYIMEPVNFLSDLIESLKILTIEYGSLKIEFDTFQEALELLPKYIRNGPFLDDNVT
AKLVYIFSDLLMNNDIEATTNIQFQSFWDNVKRISSDILVSLFGSFDQQRGFIIEELLSH
IEKLPTKRIQKKLRKVGNQNIYITDFTFTLMSMLENINCYSFCNQMKDIAPENIDLLKNE
YKKQEEFLFNIVEHINDTILERFFKNPSALRYVIDNFVQDLLLLISSPQWPVTEKILSSL
LKRLLSVYSPSMQVSANIETICLQLIGNIGSTIFDIKCSTRDHEDNNLIKMINYPETLPH
FFKSFEECIAYNETIKCRRSATRFLWNLRLGTILILEEYTKDAKEQIITVDNELKKILEQ
IKDGGLGPELENREADFSTIKLDYFSILHAFELLNLYDPYLKLILSLLAKDKIKLRSTAI
KCLSMLASKDKVILSNPMVKETIHRRLNDSSASVKDAILDLVSINSSYFEFYQQINNNYN
DDSIMVRKHVLRINEKMYDETNDIVTKVYVIARILMKIEDEEDNIIDMARLILLNRWILK
VHEVLDQPEKLKEISSSVLLVMSRVAIMNEKCSQLFDLFLNFYLLNKEAHSKEAYDKITH
VLTILTDFLVQKIVELNSDDTNEKNSIVDKQNFLNLLAKFADSTVSFLTKDHITALYPYM
VSDEKSDFHYYILQVFRCTFEKLANFKQKFLYDLETTLLSRLPKMNVREIDEAMPLIWSV
ATHRHDTARVAKACSSCLSHLHPYINKANNEEAAIVVDGKLQRLIYLSTGFARFCFPKPS
NDKIAFLQEGETLYEHITKCLLVLSKDKITHVIRRVAVKNLTKLCGNHPKLFNSRHVLHL
LDKEFQSDQLDIKLVILESLYDLFLLEERKSVRNTGVNSTLSSNSILKKKLLKTNRVEFA
NDGVCSALATRFLDNILQLCLLRDLKNSLVAIRLLKLILKFGYTNPSHSIPTVIALFAST
SQYIRHVAYELLEDLFEKYETLVFSSLSRGVTKAIHYSIHTDEKYYYKHDHFLSLLEKLC
GTGKKNGPKFFKVLKRIMQSYLDDITDLTSTNSSVQKSIFVLCTNISNITFVSQYDLVSL
LKTIDLTTDRLKEVIMDEIGDNVSSLSVSEEKLSGIILIQLSLQDLGTYLLHLYGLRDDV
LLLDIVEESELKNKQLPAKKPDISKFSAQLENIEQYSSNGKLLTYFRKHVKDT
NT seq 4482 nt   +upstreamnt  +downstreamnt
atgtcgtacccagggaaagacaagaatattcctggaagaataatagaggccctagaagac
ctgcctttgagttatctggttcctaaggatgggttagccgcgctagtaaatgccccaatg
cgggtttctttaccttttgacaagactatctttaccagcgctgatgatggcagagatgtt
aatataaatgttctaggtacagctaacagcactacttcttccataaagaatgaggccgaa
aaagaaaggcttgttttcaaaagacccagtaattttacgtcatcagccaattctgttgat
tatgtcccaactaactttttggaaggattatcaccgctagcgcagagtgttctatcaacc
cataaagggttgaatgattccattaacatcgagaaaaaaagtgaaatagtaagcagaccg
gaggcaaagcataagctcgaaagtgtgacttcgaatgctggtaacttgagtttcaacgac
aattcttccaacaagaaaaccaaaacttcaacaggtgtaaccatgacacaagcgaattta
gcggaacaatatttgaatgatcttaaaaatattttagatattgttggatttgaccaaaac
tctgctgaaattggaaatatcgagtactggctccagttgccaaataaaaaattcgtttta
actacaaactgcttaaccaaattacaaatgacaattaaaaatattaccgataacccacag
ctatcgaactcaatcgaaataacatggcttttgagattgcttgatgtgatggtttgtaat
ataaagttcagtaaaagctctttaaagatgggtttagatgattctatgttacgatatatt
gctttgctttctacaattgtactattcaatatttttttactgggtaagaatgacagcaac
ttacatcgggaatcatacatcatggaaccggtgaattttttaagcgacttgatagaatct
ctaaaaatattaacaattgaatatggttctttgaagatagaatttgacactttccaggag
gccctagaattgctaccgaaatacatacgtaacggcccttttctggatgataatgtcacg
gcaaagcttgtgtacatctttagcgacttgctgatgaataatgacattgaagcaactacg
aatatccaatttcaaagtttttgggataatgtgaagagaatcagctctgatattttagtt
tcattattcggtagttttgatcaacagagaggatttattatagaagaactactatctcat
atcgaaaagcttcccactaagagaatacaaaaaaaactaagaaaagttggtaaccaaaac
atttatatcactgattttacctttactttaatgtcaatgttagagaatattaattgctac
tccttctgtaatcagatgaaggatattgcaccagagaatattgatctattaaagaacgaa
tacaaaaagcaagaagaatttctttttaacattgttgagcatataaatgacacaatactg
gaaaggtttttcaagaacccgtccgctttaaggtatgtaattgacaactttgtccaagat
ctattattgctaatttcctcccctcagtggcctgtaacagaaaaaatactaagctctttg
ttaaagagacttctaagtgtatacagcccatccatgcaagtttctgcaaacattgaaaca
atatgtttacaacttatagggaatattggttctacaatttttgatattaaatgctcaact
agagaccatgaagataacaacttgattaaaatgattaattaccccgaaactttgccgcat
ttttttaaatcatttgaagaatgcattgcatataatgaaacgatcaaatgccgtcgttct
gcaacaagattcctttggaatttaaggctcggtacgatcttgatattagaagagtataca
aaggatgccaaagaacaaattataaccgttgacaatgaattgaaaaaaatattggagcag
ataaaagatggtggacttggacccgaattagagaacagagaagcagattttagtacgatt
aaattggattatttttctattttgcacgcctttgaactactgaatctatacgatccatac
ttgaagttgatattatcacttctagccaaggataaaatcaaactgagatcgactgctatt
aaatgtctctcgatgttggcttcaaaagacaaagtgatactttcaaacccaatggttaaa
gaaactattcaccggcgtttaaacgactcatctgcatctgtcaaggatgccattctagat
ttggtcagtattaattcttcatacttcgaattttatcaacaaattaacaacaactataac
gatgatagcataatggtaagaaaacatgtgttaagaattaatgaaaaaatgtacgacgag
acgaacgacatcgtcacgaaggtatacgtaatagcaagaatcctaatgaaaatagaagac
gaggaggacaatataattgatatggctaggctgattttattaaatagatggatattaaag
gtacatgaagtattggaccagcccgaaaagttgaaagaaatttcttcttcagtcctacta
gtaatgtcccgtgtggctataatgaatgagaaatgctcccaacttttcgacttgtttctc
aacttttatctcctaaacaaagaagcgcattcaaaagaagcatacgataaaatcactcac
gttctaaccattcttaccgactttttggtacaaaaaattgtcgagctcaactcagatgac
acaaatgaaaagaattcgattgttgataaacaaaattttttaaaccttttggcgaagttt
gctgattctactgtgtcatttttgactaaagaccacattacagcattgtatccttatatg
gtatcggacgaaaaatctgacttccactattatatcttgcaagtctttagatgcactttt
gaaaaattggccaactttaaacagaaatttttgtatgacttagagacgacccttttgagt
aggctaccaaagatgaatgtaagagagatagatgaagctatgcctcttatctggtctgtt
gccactcatcgtcatgatactgctagagtagctaaagcatgttcatcctgtctttcccat
ttacatccatatataaataaggcaaataacgaggaagctgccattgtagttgacggaaaa
ttgcaaaggctgatatatttatccaccggttttgccaggttctgctttcctaaaccctcc
aatgataaaattgcatttttacaagaaggtgaaaccctgtatgaacatattaccaaatgc
ctacttgtactatctaaagacaaaattacacacgtaataagaagggttgctgtgaaaaat
ctcactaaattatgtggaaatcatccaaaactattcaattcaagacacgttctacattta
ctggacaaagaatttcagagcgatcagctagatattaaactagtaattctagaaagttta
tatgatctttttctactggaagaaaggaagtcagtgagaaacactggcgttaatagcact
ttgtcttcgaactccattttgaaaaagaaattactgaaaacgaatagggtagagtttgca
aatgatggagtatgttcagcgttggctactagatttttagacaatattctccaactatgt
ctcctacgtgatctaaagaattctctcgtagctattcgattattaaagttgattttgaaa
tttggttacacaaatccctctcattcaattccaactgtaattgctttatttgcctctact
agccagtatattcgtcatgtcgcctatgagttgttagaagatctttttgagaaatacgaa
acgctagtattcagtagtttatctcgaggggttacaaaagctatacattattctattcat
acagatgagaagtattattacaagcacgatcattttttgtctttacttgaaaaattatgt
ggaactggaaaaaaaaatggcccaaagttctttaaagttctgaagagaatcatgcaatcc
tatttagatgatatcaccgatttaacatcaacaaatagtagtgttcaaaagtccattttc
gttctctgcactaacatttcgaatatcacatttgtttctcagtacgatttggtgtcccta
ctcaaaaccattgatttaactacagatagattaaaagaggttatcatggatgaaataggt
gacaatgtttcatcgctatccgtatcagaagaaaagctcagtggaataattttaatacag
ttaagcttacaggatttgggtacttatctactgcacttatacgggttaagggatgatgtg
cttttattagatattgtagaagaatcagaattgaagaacaaacaactccctgcaaagaag
ccggatatcagtaagttttccgcacagttggagaatattgaacagtattcatcaaatggc
aagcttcttacatattttagaaaacacgtgaaggatacgtaa

DBGET integrated database retrieval system