KEGG   Saccharomyces cerevisiae (budding yeast): YDR390C
Entry
YDR390C           CDS       T00005                                 
Symbol
UBA2, UAL1
Name
(RefSeq) E1 ubiquitin-activating protein UBA2
  KO
K10685  ubiquitin-like 1-activating enzyme E1 B [EC:6.2.1.45]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR390C (UBA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR390C (UBA2)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     YDR390C (UBA2)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   YDR390C (UBA2)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH UAE_UbL Polysacc_synt_2
Other DBs
NCBI-GeneID: 851998
NCBI-ProteinID: NP_010678
SGD: S000002798
UniProt: P52488
Structure
LinkDB
Position
IV:complement(1254937..1256847)
AA seq 636 aa
MPRETSLVTIIGEDSYKKLRSSRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSN
LNRQFLFRQKDIKQPKSTTAVKAVQHFNNSKLVPYQGNVMDISTFPLHWFEQFDIIFNAL
DNLAARRYVNKISQFLSLPLIESGTAGFDGYMQPIIPGKTECFECTKKETPKTFPVCTIR
STPSQPIHCIVWAKNFLFNQLFASETSGNEDDNNQDWGTDDAEEIKRIKQETNELYELQK
IIISRDASRIPEILNKLFIQDINKLLAIENLWKTRTKPVPLSDSQINTPTKTAQSASNSV
GTIQEQISNFINITQKLMDRYPKEQNHIEFDKDDADTLEFVATAANIRSHIFNIPMKSVF
DIKQIAGNIIPAIATTNAIVAGASSLISLRVLNLLKYAPTTKYTDLNMAFTAKASNLSQN
RYLSNPKLAPPNKNCPVCSKVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDA
SNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTC
SLPDVEVPLIKANNSPSKNEEEEKNEKGADVVATTNSHGKDGIVILDDDEGEITIDAEPI
NGSKKRPVDTEISEAPSNKRTKLVNEPTNSDIVELD
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgccaagggaaacaagtttggtaacaatcatcggtgaagatagttacaagaaattacgg
tcctcaagatgtcttctggtcggtgctgggggcatagggtctgaattgttaaaggatata
atcttgatggaatttggtgaaatacatattgtcgatttggacaccattgacctttcgaac
ttaaacaggcaatttctttttagacaaaaagatattaaacaaccgaagtctaccacagcc
gtaaaagcagtacagcatttcaataactctaagttagtgccttaccaaggaaatgttatg
gacatttctaccttcccactgcattggtttgagcaatttgacattatcttcaatgctctt
gataacttggccgcaagacggtatgtcaataaaatatcacagtttctatcactgccctta
atagaatctggaacagctggatttgatggatacatgcagcctattatccccgggaaaact
gagtgttttgaatgtacaaagaaggaaacaccaaagacttttcctgtgtgtactatcagg
tccactccttctcagccaattcattgcattgtttgggcgaaaaactttctatttaaccag
ctatttgcgtcagagacctctggaaatgaagatgataacaaccaggattggggtacagat
gatgctgaagaaattaagcgcattaaacaagaaactaatgaattgtatgaattgcaaaaa
attatcatatcaagagatgcatcccgtattccagagattcttaataaattattcattcag
gatataaataaactgctagccattgaaaatttatggaaaacgagaacaaagccagtacca
ttatcagactctcaaataaatactcctactaaaacagctcagtctgcctctaattctgtt
ggcacaatacaggagcaaattagtaatttcattaatattacacaaaaattaatggatcgc
tatcccaaagagcaaaatcatattgaatttgataaagatgatgctgatactttggaattc
gtcgcaactgctgcgaacataaggtcacacatattcaatattccaatgaagtccgtattt
gacatcaagcaaattgctggtaacattatcccggctattgcaacaacgaatgctatcgtt
gccggtgcatcgtcattgatttcactgcgcgttttaaatcttttgaaatatgccccaact
actaagtatactgatttgaatatggctttcacagcaaaggcaagcaatctatcccaaaat
cgttatttatcaaatccgaaactagcccctccaaataaaaattgcccagtttgctctaaa
gtttgtagaggtgttattaagttatccagcgattgtttgaacaaaatgaaactaagtgat
tttgtagttttaatacgcgagaagtactcatatccacaggatatttcgctcctggacgca
agtaatcaaaggttactatttgattacgatttcgaggatttgaacgatcgtactttatcg
gagattaatcttggaaatggttctataatattattctccgacgaagaaggtgatacaatg
atccgcaaagccatagaattatttcttgatgttgatgatgaactcccatgtaatacttgc
agcttaccggacgttgaagtcccattaataaaggccaacaatagtccttcaaaaaatgaa
gaagaagaaaaaaatgaaaagggtgcagatgtagtcgcaactacgaacagtcatgggaaa
gatggtatcgtgatattagacgacgatgaaggtgagatcaccatcgatgctgaaccgatc
aatggttcaaagaagaggccagttgatactgagatttctgaggcgcccagtaacaaaagg
acaaagttagttaatgaaccgactaattctgatattgttgaattagactaa

DBGET integrated database retrieval system