KEGG   Saccharomyces cerevisiae (budding yeast): YDR451C
Entry
YDR451C           CDS       T00005                                 
Symbol
YHP1
Name
(RefSeq) Yhp1p
  KO
K12411  homeobox protein YOX1/YHP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR451C (YHP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YDR451C (YHP1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain other
    YDR451C (YHP1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 852062
NCBI-ProteinID: NP_010739
SGD: S000002859
UniProt: Q04116
LinkDB
Position
IV:complement(1361120..1362181)
AA seq 353 aa
MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIY
KSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMH
SYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRT
SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHC
KVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQ
LKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggaaagcagaaataccgtgcttccttctttaccaaacattattacaggtacttctaat
tcgcctttccaactgcatactttgccaaatacaaacttccctagtgatgaccaaggtgac
atcaggttgccaccattagctgcatctgcgcacattgtgagaccagtggtaaatatttat
aaaagtccttgcgatgaggaaaggccaaaaaggaaaagtccacaggctgtggatttctta
tcacaacgtgtaaccacttccatgacgcctttatccaagcccaagaagctgagctctcat
tcaccattcacgccaacggtcagagtctgttctaaagagcagccacctcagagtatgcac
tcttataaaaaagttaatattcttactcctctatctgctgcaaaggctgttctcacacca
accacaagaaaagaaaagaaaaggtcatttgcctttattacacactcacaggaaactttt
ccaaagaaggagcctaagatagacaatgctcggttagctcgtcggaaaagaagaagaact
tcatcatatgagcttgggatattgcaaacagcatttgacgaatgtcccacgcccaataag
gctaaaaggatagagttatccgagcaatgtaatatgtccgaaaaatcggttcaaatatgg
tttcagaacaaaaggcaggctgctaaaaagcacaagaacagtggcaacaccagccattgc
aaagttcactctaatgattcgatgtctatgatatcttactcagacgctgcgttggaaatt
acctctacgccaacgagtacgaaggaggctattactgcagagttgctgaaaacttcacct
gccaatacgtcctcgatcttcgaagaccaccacataacgccttgcaagcccggcggacag
ctcaagttccacaggaaatctgtgcttgttaagagaacattatcaaataccggtcatagc
gagattatcaaaagtcctaaaggcaaggaaaaccgcctaaagttcaatgcatacgaaaga
aaaccccttggggaggtcgatctcaattctttcaaaaactaa

KEGG   Saccharomyces cerevisiae (budding yeast): YML027W
Entry
YML027W           CDS       T00005                                 
Symbol
YOX1
Name
(RefSeq) Yox1p
  KO
K12411  homeobox protein YOX1/YHP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YML027W (YOX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YML027W (YOX1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain other
    YML027W (YOX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN YdaS_antitoxin
Other DBs
NCBI-GeneID: 854981
NCBI-ProteinID: NP_013685
SGD: S000004489
UniProt: P34161
LinkDB
Position
XIII:221406..222563
AA seq 385 aa
MSQETKMLPSLSSLLSGTEISSSPVSPSFTNPRTSFHLDDRGTIKLPPLNTSINRPRSVE
SALRHTVTSLHENSSAYGDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRD
YSVSSKKNDILTPLSAAKSIIIPSASKEKRRAFAFITHSQETFPKKEPKIDNAPLARRKR
RRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATSK
STTIIQTVSPPSPPLDVHATPLASRVKADILRDGSSCSRSSSSSPLENTPPRPHHSLNRR
SSTPSIKRSQALTFHLNPQKKTLTPVKTSPNSRVNKLINSIDHSPSKAKRPVSNPSGSPK
RKRKFGFKIVDQQPLKDLDPNAFRG
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtcacaagaaacaaaaatgctaccttctctatctagtcttctatcgggaaccgaaatc
tcgtccagccccgtatcaccaagcttcactaatccaagaacgagttttcacctcgatgat
cgcggaaccataaaattaccaccgctaaacaccagtatcaatcgtccaagatctgtggaa
agcgccttgagacacactgttacatccttgcatgaaaatagcagcgcttatggtgatgac
atgctcaagcacacgcaatcagactcagccctctcatctcagttgaatagttctcaagaa
acagttgatgaatcacacgaaaaccttctactgactcccctaaatagcaaaaagagagat
tattcggtttcttcaaagaaaaacgacatattaacaccactctctgcagcgaagtcgatt
attatcccctctgcctctaaggaaaaaagacgtgcatttgctttcatcacacactcgcag
gagaccttccctaagaaggagcctaagatcgacaacgctccactagcacgccgaaagaga
agaagaacctcgtcccaggaactatctattcttcaggctgaatttgaaaaatgtcctgct
ccatcgaaggagaaacgaattgagttagctgaatcttgccatatgactgaaaaagccgtt
caaatatggttccagaataaaagacaagcggttaaaaggcagagaatcgccacttcgaag
tcaaccactataatacaaacggtatctccaccatctccgcctctggacgttcatgctacg
ccactagcatccagagtcaaggcggacatacttcgtgatggaagctcatgttctcgttct
tcctcttcttcaccgctggaaaatacgccgccaaggcctcatcattccctaaataggcgc
tcatccacaccaagcataaagagaagccaggctttaacattccatctaaacccacaaaag
aagacgttgactcccgtgaaaacgtctcccaacagcagagtaaataaattgatcaatagc
atagatcattctccatccaaagccaagcgtccggtaagcaatccctccggctcccctaaa
aggaagagaaaattcggattcaagatcgtcgatcaacaaccgttgaaggatcttgatccg
aacgctttccgtggttga

DBGET integrated database retrieval system