KEGG   Saccharomyces cerevisiae (budding yeast): YEL037C
Entry
YEL037C           CDS       T00005                                 
Symbol
RAD23
Name
(RefSeq) Rad23p
  KO
K10839  UV excision repair protein RAD23
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YEL037C (RAD23)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YEL037C (RAD23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YEL037C (RAD23)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YEL037C (RAD23)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    YEL037C (RAD23)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      YEL037C (RAD23)
SSDB
Motif
Pfam: UBA ubiquitin XPC-binding Rad60-SLD Rad60-SLD_2 Ubiquitin_5 Dsc3_N EAD1 UBA_2 RepB
Other DBs
NCBI-GeneID: 856674
NCBI-ProteinID: NP_010877
SGD: S000000763
UniProt: P32628
Structure
LinkDB
Position
V:complement(81407..82603)
AA seq 398 aa
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSEC
GLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEG
SQPQEEQTATTERTESASTPGFVVGTERNETIERIMEMGYQREEVERALRAAFNNPDRAV
EYLLMGIPENLRQPEPQQQTAAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTT
GGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEV
FVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQVDYTPEDDQA
ISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggttagcttaacctttaaaaatttcaagaaggaaaaagttcctttagatctggaacct
tcaaacacaattttagagaccaagaccaagcttgctcaatccatttcttgtgaagaatct
caaataaaactgatctactcgggtaaagtgctacaagattccaaaaccgtatcggaatgc
gggctaaaagatggggaccaagttgtcttcatggtttctcaaaaaaagtccacgaagacc
aaagtaacagaacctccaattgctcctgagagcgccactacccccggaagagaaaattct
acagaagcatcccccagtacggatgcttctgcagctcctgcagccactgctcccgaaggc
tcacaaccgcaagaagaacaaaccgccactacagaacgtactgaatctgcctctacaccg
ggattcgtggtgggaaccgagaggaacgagaccatcgagagaatcatggaaatgggctac
caaagagaggaagtcgaacgagccttgagagcagcctttaataatccagatagagcggtg
gaatatctactgatgggtattccagaaaatctgcgtcaaccggaaccacagcaacaaaca
gccgccgcagcggaacaaccatcgacagccgccaccactgcggaacaaccggctgaagac
gacttatttgcacaagctgcccaaggcggtaatgcttcatccggtgcgcttggcacaact
ggaggagctacagatgctgcgcaaggtggacctccaggttccattggcctcactgtagaa
gatttactatcgttgagacaggtcgtttcaggtaacccagaagctttagccccattgttg
gaaaacataagtgctagatatcctcaattacgtgaacatatcatggcaaacccagaagtg
tttgtgtccatgttgctagaagccgtgggtgacaatatgcaagatgttatggaaggtgcg
gatgatatggtggaaggagaggatatagaagttacaggagaggctgctgctgcaggactg
ggacaaggtgaaggtgaaggttctttccaagttgactatacccccgaagacgatcaagct
atttcgcgcctctgtgaattgggctttgaaagagatcttgttatccaggtgtattttgcg
tgcgataaaaacgaagaagctgcagcaaatattctattcagcgatcatgccgactga

DBGET integrated database retrieval system