KEGG   Saccharomyces cerevisiae (budding yeast): YER147C
Entry
YER147C           CDS       T00005                                 
Symbol
SCC4
Name
(RefSeq) cohesin-loading factor complex subunit SCC4
  KO
K06673  cohesin loading factor subunit SCC4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YER147C (SCC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YER147C (SCC4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    YER147C (SCC4)
SSDB
Motif
Pfam: Cohesin_load
Other DBs
NCBI-GeneID: 856890
NCBI-ProteinID: NP_011074
SGD: S000000949
UniProt: P40090
Structure
LinkDB
Position
V:complement(462968..464842)
AA seq 624 aa
MENLGDKLSISQVYHLAQEYRDHAYSIANKIGSEEGLKQYYGLMNMSIQMFQLLKTKCTL
SVLEDSKVTFEMVELLIQETYNFDLAELYISSLKERLQTHQSDTDLVEEIMRCEFLLLHD
LPLMRDSKFHYKIALRNCNELVQYMVNLQDELYQNWASVFQYVGVMLCIKLKQHRRVKTS
FHGLLSQCREKSQWKWFLNLCYVNYLLNERFPIPEDALQELRSTELHTVGPELYAWKLAL
EMVIQLCKDGNITDHLNEFKNFFDTNKQSLVTNEGKGCVIKIMPRIALKVELPMIFHYKE
LKNILLLLQSVSYIVNCYDEKGNFSRKFLPKVYSTTQKLIKNIAAGGVSMNELDSRIQTY
KSILEFCEFYKVWEQTLLKGAVVTTESPKLGPSPGYVRLLQAMKVQFEGGGAVEEYTRLA
QSGGTSSEVKMISLLNCYTVQAARVSRCSGDKQGELVEQCNKVWLQVEKLLQETDLQFNP
IWECTVTILWLFSHFEPFSWNPLPCSDKQRAEYVSKLREFYSSNKFVAGEAVADNRFKLK
KALLLQILVNYLGGRMLEHDLGEIYAISAKCFDMCRQQGGMRKVQYVIGIWHLMNCTVAM
RGKDVALTNAKLEALVKQITSVKQ
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggaaaatcttggcgacaaacttagtatttcacaagtataccacttagcacaggaatac
agagaccatgcatattcaattgcgaataaaatcggttctgaggaagggttgaagcagtat
tatggcctcatgaacatgtctatccagatgtttcagctattgaaaacgaaatgtacgctt
tcagttctggaggatagtaaggtcacgtttgagatggtggagttattgatacaggagacg
tataattttgacctagcagagctttacatttccagtttgaaagaacggttacaaacgcac
cagagcgacacagatttggtagaagagatcatgcgttgcgagtttctgctgttacatgac
ttgccacttatgagagacagtaagttccactataagattgcactaagaaattgcaatgaa
ttagtccagtacatggtaaatttgcaggatgagttgtatcaaaattgggcatccgtattc
cagtatgtcggcgtgatgctttgcattaagctgaaacagcaccgcagggtgaagacgagt
tttcatgggctactctcgcaatgtcgggaaaagtcacaatggaaatggtttctaaatctg
tgttatgtgaattacttgctaaatgagaggttcccaatccccgaggatgctctgcaggag
ctgcgaagcacggagctgcacacggtggggcctgagctatatgcatggaagttggcatta
gagatggtaatccagctttgtaaagacgggaatattacggaccacttgaacgaattcaaa
aatttctttgacacaaacaagcaatctctagtcactaatgaaggtaagggatgtgtgatc
aaaatcatgccaaggatagcgctgaaagtagagttgcctatgattttccactacaaagaa
ttaaagaacatactgttattattgcaaagtgtcagctacatcgtgaactgttatgacgaa
aagggcaatttttccaggaagttcctccccaaagtctattctacaacgcagaaactgatt
aagaacattgccgctggcggtgtttcgatgaatgagctggactcacgaatccagacatac
aagagcattcttgaattctgtgagttttacaaagtgtgggaacaaacactcttgaagggg
gccgtagtgacgaccgagtcacctaagttagggccctctccaggctacgtgaggctgctg
caagccatgaaggttcagtttgaaggcggcggggccgtagaagagtacacgcggcttgca
caatctggcggtacatccagcgaggtgaagatgatatcgcttctgaattgctacacagtg
caggcggcaagagtgagccgatgttcgggggacaaacagggcgaactcgtagagcaatgc
aacaaggtgtggcttcaggtggagaaattgctacaagaaacggatctgcagttcaacccc
atatgggagtgcacagtaacgatcctatggcttttcagccatttcgagccgttcagttgg
aacccgctgccatgtagtgacaagcagcgcgccgagtacgtgtcgaagctccgcgagttc
tactctagcaacaagttcgttgccggagaagccgttgcggacaaccgcttcaaattgaag
aaggctctgttgctgcaaatactggtaaactacttaggcggtcgaatgctcgaacacgat
ctgggcgagatctatgcgatttcagcaaagtgtttcgatatgtgccgccagcagggcggc
atgcgcaaggtccaatacgtgatcggaatatggcatttaatgaattgtacggtggcgatg
cggggaaaagacgtcgctctcacgaacgcgaagctggaggcgctggttaagcaaatcacc
agtgtcaaacaataa

DBGET integrated database retrieval system