KEGG   Saccharomyces cerevisiae (budding yeast): YFL009W
Entry
YFL009W           CDS       T00005                                 
Symbol
CDC4
Name
(RefSeq) SCF ubiquitin ligase complex subunit CDC4
  KO
K03361  F-box and WD-40 domain protein CDC4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YFL009W (CDC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFL009W (CDC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YFL009W (CDC4)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     YFL009W (CDC4)
SSDB
Motif
Pfam: WD40 CDC4_D F-box-like NBCH_WD40 ANAPC4_WD40 F-box RAMA PRANC
Other DBs
NCBI-GeneID: 850539
NCBI-ProteinID: NP_116585
SGD: S000001885
UniProt: P07834
Structure
LinkDB
Position
VI:116145..118484
AA seq 779 aa
MGSFPLAEFPLRDIPVPYSYRVSGGIASSGSVTALVTAAGTHRNSSTAKTVETEDGEEDI
DEYQRKRAAGSGESTPERSDFKRVKHDNHKTLHPVNLQNTGAASVDNDGLHNLTDISNDA
EKLLMSVDDGSAAPSTLSVNMGVASHNVAAPTTVNAATITGSDVSNNVNSATINNPMEEG
ALPLSPTASSPGTTTPLAKTTKTINNNNNIADLIESKDSIISPEYLSDEIFSAINNNLPH
AYFKNLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLG
VSQNWNKIIRKSTSLWKKLLISENFVSPKGFNSLNLKLSQKYPKLSQQDRLRLSFLENIF
ILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSG
HDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYI
VTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHG
NIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLE
NIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDAN
DYSRKFSYHHTNLSAITTFYVSDNILVSGSENQFNIYNLRSGKLVHANILKDADQIWSVN
FKGKTLVAAVEKDGQSFLEILDFSKASKINYVSNPVNSSSSSLESISTSLGLTRTTIIP
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggggtcgtttcccttagctgagtttccattacgtgatatccctgttccttatagctac
cgtgtgtctggcggtatagcttcctcaggtagtgttactgcgcttgttactgccgctggc
actcatcgaaactcgtccacggctaagacagttgagacagaagacggcgaagaagatatc
gatgagtatcagaggaaaagagcagctggttctggcgaatccactcctgaacgcagtgat
ttcaaaagggtaaaacatgataatcacaaaaccctccatccagttaacttacagaacacc
ggtgcagcgtctgtggataatgacggtctgcacaatttaacagatatatccaacgatgca
gaaaaacttttgatgtctgtggatgatggttctgccgcaccttctacattgagtgtaaac
atgggagtggcatctcataatgttgctgctcccactaccgtcaatgcggcaacaataact
ggcagtgatgttagtaacaatgttaatagtgctactattaacaatcctatggaggaagga
gcgctgccgttatcacccactgcttcctctccaggtaccacaactcctttagctaaaact
acgaaaactatcaacaacaataataatatcgccgatttgatagaatccaaagattctata
atctcccctgaatacctttctgatgagattttcagcgcaataaacaataatctccctcac
gcatacttcaaaaatttattatttagattagttgccaacatggataggagtgaactatcc
gacttggggactttaatcaaggataatttaaagagggacctaataacgtctttgcctttt
gaaataagtttgaaaattttcaattatttgcaattcgaggatattataaattcccttggg
gtctcccaaaattggaacaaaataattagaaaatctacatcgttgtggaaaaaacttctg
atatcggaaaattttgtgagcccaaagggttttaattctctcaatctcaaactctcccaa
aaatacccaaaactctcacaacaagatcgccttagattatcttttctggagaatatattc
attttaaaaaattggtacaatcccaagtttgtaccacaaaggaccacgttaagaggccat
atgacgagtgttattacgtgcttgcaatttgaagataattatgtcattacgggggctgat
gacaaaatgatcagagtttatgattcgataaacaagaaatttcttctacaactatcaggt
catgatggtggggtttgggcattgaagtatgcccatggcggtattttagtcagcggttct
acagacagaacggtgcgagtttgggatattaagaaaggttgttgtacccatgtgtttaaa
ggtcataactctacggtgaggtgcctagatatagtagaatataaaaatatcaagtacatt
gttactggttcgagagataacactttgcacgtttggaaattgcccaaggagtcctccgtt
cctgatcatggggaagaacatgattatccattagtctttcatacccctgaggagaaccca
tattttgttggtgttttaagaggacatatggcatctgtaagaactgtctcaggccacggt
aatattgtcgttagtggctcctatgataatacactgattgtgtgggatgttgcgcaaatg
aaatgtttgtatattttaagtggacatacggatcgtatttattcgacaatctacgatcat
gaaagaaaaaggtgcatctctgccagtatggataccactattagaatttgggatttggaa
aatatatggaataatggagaatgttcctacgcaacaaattcagcatcgccatgcgccaaa
atacttggtgctatgtacactttgcagggtcatacagctttggtcggtttattaagatta
tccgacaaatttttggtcagtgccgctgcagacggttcaataaggggttgggacgcaaac
gactactctagaaaattttcctaccatcataccaatttgagtgcaattaccacattttat
gtatcggataatattttggtgagtggatcggaaaatcagttcaacatctataatctacgg
agtgggaaattggtccacgcaaatattctaaaagatgctgatcagatttggtcggttaat
tttaagggcaaaacacttgttgcagcagttgaaaaagatggacagagctttttagaaatt
ctggatttcagcaaagcttcaaaaattaactacgttagcaatcccgtaaactcctcgtcg
tcgtctttggaatccatttctacttctttgggtctaacgaggacaactataataccatga

KEGG   Saccharomyces cerevisiae (budding yeast): YIL046W
Entry
YIL046W           CDS       T00005                                 
Symbol
MET30, ZRG11
Name
(RefSeq) ubiquitin-binding SDF ubiquitin ligase complex subunit MET30
  KO
K10259  F-box and WD-40 domain protein MET30
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YIL046W (MET30)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YIL046W (MET30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YIL046W (MET30)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     YIL046W (MET30)
SSDB
Motif
Pfam: WD40 F-box-like Nup160 NBCH_WD40 F-box WD40_like
Other DBs
NCBI-GeneID: 854765
NCBI-ProteinID: NP_012218
SGD: S000001308
UniProt: P39014
LinkDB
Position
IX:268651..270573
AA seq 640 aa
MRRERQRMMSFEDKDKDDLDNSNSNNSSEMTDTAMMPPLKRLLITGSSDDLAQGSSGKKK
MTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQ
EINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIK
IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCG
WGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKG
HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSL
DKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH
TEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENL
ATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVK
TGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT
QTQSLGDKVAPIACVCIGDSECFSGDEFGCVKMYKFDLND
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgaggagagagaggcaaaggatgatgagtttcgaggacaaggacaaggacgaccttgac
aatagtaatagtaataacagcagtgaaatgacagatacggcgatgatgccaccattaaag
agattgcttattacgggcagtagcgatgatttggcacaaggatcatcgggtaagaagaag
atgacgatggcgacgaggtcgccatcgtcatcacccgatttggcgacaaacgacagcggc
actagggtacagccattgccagaatataacttcaccaagttctgctatcggcataacccg
gacattcagttctcaccaactcatacagcgtgctacaagcaggatttgaaacgaacgcaa
gagattaatgctaatatcgcgaagctacccctgcaggagcaatccgacatccaccacatt
atctcgaagtacagcaattccaatgacaagatacggaagctgattctggatgggatccta
tcgacgagttgcttcccacagctttcctacatttcgtcactcgttacacacatgatcaag
atcgacttcatcagcattctgccgcaggagctgtcgctgaagatcttgagttatctggat
tgccaatctctttgcaacgccacgagagtgtgccgcaagtggcagaagctcgcggatgac
gacagggtatggtaccacatgtgcgagcagcacatagacaggaaatgtcccaactgtggc
tgggggctgcctcttttgcacatgaaacgtgcgcggatacaacagaatagtacaggatct
agcagcaacgcagatatccagacgcaaactacgcgaccttggaaagtcatctacagagaa
cggttcaaagtggagtcaaactggagaaagggccactgcaggattcaggaattcaagggc
cacatggatggtgtgttaacgctccagtttaactacaggcttttgttcacaggctcgtac
gactccaccataggtatatgggacttattcacggggaagctaatacgaaggctcagcggc
cattcggacggcgtcaagacattatattttgacgatagaaagctgattacgggctcgctc
gacaagacgatccgtgtttggaactacataaccggtgaatgcatttccacgtatcgaggc
cactcggatagcgttctgagcgtagattcataccagaaggttatcgtttccggcagtgct
gacaagacggtcaaggtatggcacgtggagtccaggacatgctacaccttgagaggccac
acggaatgggttaattgcgtcaaattgcatccgaaaagcttttcatgttttagttgcagt
gacgataccacaatccgaatgtgggatatcaggaccaattcatgcctaaaagtgttcagg
ggtcatgtagggcaggtgcaaaagatcataccgcttaccattaaggatgtagagaatcta
gccaccgacaacacttctgatggcagctctccgcaggatgacccaacaatgactgatggt
gcagacgaatcagacacaccgtcgaacgagcaagaaactgtcttagatgaaaacatacct
tatccaacacatctactatcttgcggactggataacacaatcaaactatgggacgtcaaa
accggtaaatgcataagaacacagtttgggcacgtggaaggtgtttgggacatcgccgct
gacaacttcagaattataagtggttctcacgacggaagcattaaggtctgggacttgcaa
agcgggaagtgtatgcacacgttcaacggtcgaagactacaaagagaaactcagcacaca
caaacacaatccttgggtgataaagtcgcccctatcgcttgtgtttgtattggagattca
gaatgctttagtggtgatgaatttgggtgcgtaaaaatgtacaaattcgatctcaatgat
tag

KEGG   Saccharomyces cerevisiae (budding yeast): YJR090C
Entry
YJR090C           CDS       T00005                                 
Symbol
GRR1, CAT80, COT2, RMR3, SDC1, SSU2
Name
(RefSeq) SCF ubiquitin ligase complex subunit GRR1
  KO
K03360  F-box and leucine-rich repeat protein GRR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YJR090C (GRR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJR090C (GRR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YJR090C (GRR1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     YJR090C (GRR1)
SSDB
Motif
Pfam: F-box-like F-box
Other DBs
NCBI-GeneID: 853552
NCBI-ProteinID: NP_012623
SGD: S000003850
UniProt: P24814
LinkDB
Position
X:complement(590872..594327)
AA seq 1151 aa
MDQDNNNHNDSNRLHPPDIHPNLGPQLWLNSSGDFDDNNNNNNNNNNNNSTRPQMPSRTR
ETATSERNASEVRDATLNNIFRFDSIQRETLLPTNNGQPLNQNFSLTFQPQQQTNALNGI
DINTVNTNLMNGVNVQIDQLNRLLPNLPEEERKQIHEFKLIVGKKIQEFLVVIEKRRKKI
LNEIELDNLKLKELRIDNSPQAISYLHKLQRMRLRALETENMEIRNLRLKILTIIEEYKK
SLYAYCHSKLRGQQVENPTDNFIIWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPS
NQNICTSVTRRSPVFALNMLPSEILHLILDKLNQKYDIVKFLTVSKLWAEIIVKILYYRP
HINKKSQLDLFLRTMKLTSEETVFNYRLMIKRLNFSFVGDYMHDTELNYFVGCKNLERLT
LVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVT
FDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLL
TRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK
LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFAC
CTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSNLTI
YPIYELLMSCPRLSHLSLTAVPSFLRPDITMYCRPAPSDFSENQRQIFCVFSGKGVHKLR
HYLVNLTSPAFGPHVDVNDVLTKYIRSKNLIFNGETLEDALRRIITDLNQDSAAIIAATG
LNQINGLNNDFLFQNINFERIDEVFSWYLNTFDGIRMSSEEVNSLLLQVNKTFCEDPFSD
VDDDQDYVVAPGVNREINSEMCHIVRKFHELNDHIDDFEVNVASLVRVQFQFTGFLLHEM
TQTYMQMIELNRQICLVQKTVQESGNIDYQKGLLIWRLLFIDKFIMVVQKYKLSTVVLRL
YLKDNITLLTRQRELLIAHQRSAWNNNNDNDANRNANNIVNIVSDAGANDTSNNETNNGN
DDNETENPNFWRQFGNRMQISPDQMRNLQMGLRNQNMVRNNNNNTIDESMPDTAIDSQMD
EASGTPDEDML
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggatcaggataacaacaaccacaatgacagcaataggctgcacccacctgatatacat
ccaaatttgggccctcaattgtggctgaatagtagcggtgattttgacgacaacaacaac
aacaacaacaacaacaacaataataatagcacaagaccacaaatgccatcacgaactaga
gaaacggcaacttcggaaagaaatgcaagtgaggttagggatgcaacgctaaataatatc
tttaggttcgatagtattcaacgggaaacgcttttgccaaccaacaacggacaaccgcta
aatcaaaacttttcgctgacatttcaaccacaacagcaaacaaatgcgctgaacgggatt
gacataaacactgtgaacacaaaccttatgaatggtgtcaatgttcaaatagatcaactt
aatcgattgttaccgaacctaccagaggaagaacggaagcaaatccacgaattcaagcta
atagtgggcaaaaaaatccaagagtttctggttgttatagagaaacgtagaaaaaaaata
ctgaacgaaattgagctagacaaccttaaactaaaggagctacgtattgataactcccca
caagcaattagttatttgcataaattacaaagaatgaggcttagggcgctagagacagaa
aacatggaaattagaaatttaaggctaaaaatattaacaattatagaagagtacaaaaag
tcattatatgcatactgccattccaagctaagaggtcaacaagtggaaaatccaacagat
aatttcatcatttggataaactccatagatactactgaatcatctgacttgaaagaaggg
ctacaagatctttcgagatattcaaggcagttcataaataatgtgctttcgaatccatca
aatcaaaacatatgtacgagtgtcacccgaagatcacctgtgtttgccctaaacatgcta
ccctcggaaatattacacttaatattagataaacttaaccaaaaatatgatattgtaaaa
ttccttaccgtttccaaactctgggctgaaataattgtgaagatactttattacagaccg
cacatcaacaaaaagagtcaattagacttgtttttaaggactatgaagttaacttctgaa
gaaactgtattcaactatcgtttaatgatcaaaagattaaatttttcatttgttggtgac
tacatgcacgatacagagcttaactattttgtcggatgtaagaatttggagcgactaact
ttagtattttgcaagcatataaccagtgttccaatatcggctgttttgagaggatgtaaa
tttctccaaagtgtggatatcactggaataagagacgtttccgatgacgtatttgatacc
ttagcgacatattgtcccagagtacagggcttttatgttcctcaggcaaggaatgtaaca
ttcgattcactgcggaatttcatagtccattccccgatgttgaaaagaataaaaatcaca
gcaaacaataacatgaatgacgaattagtagaactattagccaacaaatgccctttgctt
gtagaggtcgatataacattaagtccaaatgtcactgattctagtttgttaaaactcctc
actaggttagttcagctgagggaattcagaataactcataatacgaatattacggataat
cttttccaggagctttctaaagtagttgacgatatgccctctttaagattgattgatctt
tctggatgtgaaaatattacagataaaactatagaaagtatagtcaatttagcccctaaa
ttacgtaatgtttttctaggcaagtgtagccgaattacagatgcatcgttgttccaatta
tcgaagctgggcaaaaacttgcaaacagtgcattttgggcactgtttcaatataactgat
aacggggtaagagcactctttcattcatgtacaagaatacagtatgtggactttgcgtgc
tgtacgaatttaaccaatagaactctttatgaactagcagacttaccaaaattaaagaga
attggccttgtcaaatgtacgcaaatgactgacgagggtttgttgaatatggtttccttg
cgaggccgaaatgatactttagaaagggtacatttatcttactgttctaatttaacaata
tatccgatatatgagcttctaatgtcttgcccaaggctctcacatttgtctttgactgct
gttccgtcatttttacgccccgatataacgatgtattgcaggcctgcaccctcagacttt
agtgaaaatcaacgtcaaatattctgcgtattttcagggaaaggtgttcataaacttcgc
cattatttagtaaatttaacgtcgcccgcttttggaccacatgtcgatgtaaatgatgtt
ttgacaaaatatattagatccaagaatttgatatttaacggtgaaacacttgaagatgct
cttaggagaatcataactgatttaaatcaagattccgctgcaattatagctgctacagga
ttaaatcaaatcaacggtctaaataacgattttcttttccagaatatcaattttgaacga
atagatgaagtattcagttggtatctcaatacttttgatggcattaggatgagctcggag
gaagttaactcactattattgcaagtaaacaagacgttttgtgaagatccatttagtgat
gtggacgatgatcaagattatgtcgtagcacctggtgtaaaccgggaaattaacagtgaa
atgtgtcatattgttagaaaattccatgagttaaatgatcatattgatgatttcgaggtg
aatgttgctagtttggtaagagttcagtttcagtttactggttttttacttcatgaaatg
actcaaacctatatgcaaatgattgaattaaacagacaaatttgtttagtacaaaaaacg
gttcaggaatcgggcaacatagattaccaaaaagggcttttaatatggcgacttttattc
attgacaaattcattatggtggttcagaagtacaagctctccaccgttgttttgagacta
tatttaaaagataacataacattgttaaccagacaaagagaactattaatagcccaccaa
agatcagcatggaataacaataatgacaatgacgccaaccggaacgccaacaacatagtg
aatattgtatcggatgctggggcaaacgatacaagtaacaatgaaactaacaatggtaat
gatgacaatgaaacagaaaatccaaatttctggcgtcagtttggcaatagaatgcaaata
tcacctgaccagatgaggaatctccaaatgggacttcgtaatcagaacatggttaggaac
aataacaacaacacaattgacgaatcaatgcctgacactgccattgattctcaaatggat
gaagcatcaggaacgcccgatgaagatatgttataa

DBGET integrated database retrieval system